KEGG   Rattus norvegicus (rat): 100233213Help
Entry
100233213         CDS       T01003                                 

Gene name
Fam196a
Definition
(RefSeq) family with sequence similarity 196, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM196
Motif
Other DBs
NCBI-GeneID: 100233213
NCBI-ProteinID: NP_001137275
RGD: 2302685
Ensembl: ENSRNOG00000033881
UniProt: D4A4J1
Position
1q41
AA seq 470 aa AA seqDB search
MVSKDTGRCILTTPEQEVEPAACLALEMRYALDPNRQIKKRNKALQVRFKDICEAQNEQR
DTQLSSGPLGEKREAKAVSCRVAYRKYMTVPARRSIPNVTKSTGVQTSPDLRKCYQTFPL
DRKKGSLKGLPAADTFKSQNNGFLADSKEKSEAGPTEDPRPCSAGRIHKTTALVFHSNEH
VNALDQPSGVNCAELCKSPDVLGYPEALLQNSRPPSEEPIHQLQGRAKPDRGTLDSEEPT
PLTHGRVFKTEVATVYPPAKSTRAPEPGLSNSAAASQWSLCPTEEEQRRAAHLNGLQVST
GSAVACSTPVQCLSPECSEQPLQNQPSPTAGVGDEERQQIVPHTEVVDLKAQLQVMENLI
SSSQETIKVLLGVIQELEKGEAHREGLSYRTGQDTANCDTCRNSACIIYSVELDFKQQED
KLQPVLRKLHPVEETQVAPLPYTQEAHSSTPKQKSKTESKKHGRWKLWFL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaaggacactggcagatgcatactcacaacaccagagcaggaagtggagccc
gccgcctgcctggccctggagatgagatacgccctggaccccaacaggcagatcaaaaag
cgtaacaaagccctgcaggtgcgctttaaggatatctgtgaggcccagaatgagcagaga
gacacacagttgtcttcgggacctctgggggagaagcgagaggccaaggctgtgtcctgc
agggtggcatatcgtaagtatatgacggtgcccgcacgccggtccattcccaacgtcacc
aagagcaccggtgttcagacctcaccggaccttcgcaagtgttaccagacattcccgctg
gaccgcaagaaaggcagtctcaaaggcctgccagctgcagataccttcaaaagccagaac
aatgggtttctagcagattcaaaagagaagagcgaggcagggcccacggaggaccctcgg
ccttgcagtgcaggaaggattcacaagaccacagcattggttttccattccaacgaacac
gtgaatgcgctggaccagccctctggggtcaactgtgcggagctctgcaagtccccggat
gtgctcggctaccctgaggctcttttgcagaactctcggcctccctctgaggagcccatc
caccagctgcaggggagagctaagcctgacaggggcaccctggactcagaggaacccact
ccactcacccatggaagggtgtttaagacagaggtcgccactgtgtatccacctgccaaa
agcaccagggcccctgagcctggcttgtcaaactctgctgctgccagccaatggtctctc
tgccctacagaggaggagcagaggcgggccgcccacctcaatgggctgcaggtatccaca
ggctcggctgtggcctgctcaaccccggtgcagtgcctgtccccagaatgtagcgaacag
cccctgcagaaccagcctagccccacagctggggtaggggatgaagaacgccaacaaatt
gtgcctcacacagaagtggtagacctcaaggcccagctgcaggtgatggagaacttaatc
agctccagccaggagaccatcaaagtgctgctgggagttattcaggagctggagaaagga
gaagcccatcgggaagggctttcatatcggacggggcaagacacagctaattgtgacacg
tgcaggaacagtgcatgtattatctatagtgtggagctggattttaagcagcaagaagac
aaactgcagcccgtgctgagaaaactgcaccctgtcgaggaaactcaggtcgcccctttg
ccttacactcaggaggctcactcctccacgcccaagcaaaaatccaaaactgagtccaaa
aagcacggaaggtggaaactctggttcctttaa

DBGET integrated database retrieval system