KEGG   Rattus norvegicus (rat): 100312670Help
Entry
100312670         CDS       T01003                                 

Gene name
Vom1r39
Definition
(RefSeq) vomeronasal 1 receptor 39
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100312670 (Vom1r39)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    100312670 (Vom1r39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V1R TAS2R 7tm_1
Motif
Other DBs
NCBI-GeneID: 100312670
NCBI-ProteinID: NP_001161023
RGD: 2316471
Position
1
AA seq 305 aa AA seqDB search
MPAPDKSLKTTEEVALQILLLCQFGVGTVANIFLFIHNFSPILTGSQQRATHMILTNIAV
ANTLILFVTVFPINMMTFAQRSPLTDLKCKFEFFTRLVARSTNLCSTCVLSIQQFLTLVP
VHRSKVLLRANVPNFATYSCCSCWVFSVLNNIYIPVMVTGPQITDNKTDSKRKLFCSTSG
FTVGIVFLRFIHDVTFISIMVWTSVSMVLLLHRHLQRMQHILTPNQNTRGQAETRATHTI
LMLVVTFVSFYILNFICIIFHNFFMDSRLFVRHVSEALVLGFPTISPLLLIFRDPKNPCS
VLFSS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcctgataaatccttgaaaacaactgaggaagtggctcttcagatccttttg
ctttgtcagtttggggttgggactgtggccaatatttttctgtttatccataatttctct
ccaatcttaactggttctcaacagagggccacacatatgattttaacaaacatagctgtg
gccaataccttgattctcttcgtcactgtctttccaatcaacatgatgacttttgctcaa
agaagtcctctaactgacctcaaatgtaaatttgaatttttcactcgcctggtggcaaga
agcaccaacttgtgttccacctgtgtcctgagtatccaacagtttctcactcttgttcct
gttcatagaagtaaagttttgcttagagcaaatgtcccaaattttgctacttactcttgt
tgcagttgttgggtcttcagtgtgttaaataacatctacattccagttatggtcactggt
cctcagataacagacaataaaactgattcaaaaagaaagttgttctgttccacatctgga
ttcactgtaggcattgtcttcttgaggtttatccatgatgtcacattcattagcatcatg
gtctggaccagtgtctccatggtgcttctcctccatagacatctccagcgaatgcagcac
atcctgactcccaatcagaacaccagaggtcaagctgagacaagagcaacccatactatc
ctgatgttggtggtcacatttgttagcttttatattctaaattttatttgtatcatcttt
cacaacttttttatggattcacgcctctttgtgaggcatgtcagtgaagctttggtctta
ggattccccacaatttctcccttattgttgatcttcagagatccaaagaatccttgttct
gtgttattcagctcttga

DBGET integrated database retrieval system