KEGG   Rattus norvegicus (rat): 100359498Help
Entry
100359498         CDS       T01003                                 

Definition
(RefSeq) ribosomal protein L35a-like
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Module
rno_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100359498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    100359498
Ribosome [BR:rno03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    100359498
  Archaea
    100359498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L35Ae RimM DUF2080
Motif
Other DBs
NCBI-GeneID: 100359498
NCBI-ProteinID: XP_002727941
RGD: 2323795
UniProt: P04646
Position
11q22
AA seq 110 aa AA seqDB search
MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTP
GGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaggctgtggtgcaaggccatttttgctggctacaagcgaggcctccggaac
caaagagagcacacggctcttcttaaaattgaaggtgtttatgcccgagatgaaactgag
ttctacttaggcaagaggtgtgcttatgtgtacaaagcaaaaaacaatacagtgactcct
ggaggcaaaccaaacaaaaccagagtgatctggggaaaagtaactcgggcccatggaaac
agtggcatggttcgtgccaaattccgaagcaaccttcctgcaaaggccattggacacaga
atccgtgtgatgctgtacccatcccggatttaa

DBGET integrated database retrieval system