KEGG   Rattus norvegicus (rat): 100359529
Entry
100359529         CDS       T01003                                 

Gene name
Immp2l
Definition
(RefSeq) inner mitochondrial membrane peptidase subunit 2
  KO
K09648  mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    100359529 (Immp2l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    100359529 (Immp2l)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    100359529 (Immp2l)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100359529 (Immp2l)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S26: signal peptidase I family
   100359529 (Immp2l)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    100359529 (Immp2l)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 DUF2798
Other DBs
NCBI-GeneID: 100359529
NCBI-ProteinID: XP_002726783
RGD: 2323665
Position
6q21
AA seq 175 aa
MAQSQGWVRRCFKAFCKGFFVAVPVAVTFLDRVVCVARVEGSSMQPSLNPGGSQSSDVVL
LNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIIRPIGYKNQLVKVPRGHMWV
EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERSPVHTSEE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcacagtcacaaggctgggtgcgaagatgcttcaaggccttttgcaaaggcttcttt
gtggcggtgcctgtggcagtcactttcttggatcgggtggtctgtgtggctcgagtggag
ggatcgtcgatgcagccttctttgaatcctgggggaagccagtcctcagatgtggtactt
ctgaaccactggaaagtgaggaattttgaagtacagcgtggtgacattgtgtcattggtg
tctcctaaaaacccagagcagaaaatcattaagagagtgatcgctcttgaaggagatatt
ataagacccattggatacaaaaaccagttggtcaaagtcccccgtggtcacatgtgggtt
gaaggagatcatcatggacacagttttgatagtaattcttttggaccggtttctctggga
ctcctgcatgcccatgctacacatatcttgtggcctccagagcgctggcagaaactggaa
tctgttcttcctccggagcgctccccagtccatactagtgaggagtaa

DBGET integrated database retrieval system