KEGG   Rattus norvegicus (rat): 100359583
Entry
100359583         CDS       T01003                                 

Definition
(RefSeq) prothymosin alpha
  KO
K13784  prothymosin alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99998 Others
    100359583
SSDB
Motif
Pfam: Prothymosin
Other DBs
NCBI-GeneID: 100359583
NCBI-ProteinID: XP_003751326
RGD: 2323611
Ensembl: ENSRNOG00000025731
UniProt: P06302
Position
13
AA seq 112 aa
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagacgcggcagtggacaccagctccgagatcaccaccaaggacttgaaggagaag
aaggaagttgtggaggaggcagagaatggaagagacgcacctgccaatgggaacgctcaa
aatgaggaaaatggggagcaggaggctgacaatgaggtagatgaagaagaggaagaaggt
ggggaggaagaggaggaggaagaagaaggtgatggtgaggaagaagatggagatgaagat
gaggaagctgaggctcctacgggcaagcgggtagctgaggatgatgaggatgatgatgtt
gagaccaagaagcagaagaagactgatgaggatgactag

DBGET integrated database retrieval system