KEGG   Rattus norvegicus (rat): 100359675Help
Entry
100359675         CDS       T01003                                 

Gene name
Alpp
Definition
(RefSeq) alkaline phosphatase, placental
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00730  Thiamine metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100359675 (Alpp)
   00790 Folate biosynthesis
    100359675 (Alpp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100359675 (Alpp)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    100359675 (Alpp)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100359675 (Alpp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100359675 (Alpp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  100359675 (Alpp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100359675
NCBI-ProteinID: XP_002727285
RGD: 2325055
Ensembl: ENSRNOG00000033672
Position
9q35
AA seq 531 aa AA seqDB search
MAMWGACLLLLGLSLQMSLSLVPVEEENPAFWNRKAAEALEAAKKLQPIQTSANNLIILM
GDGMGVSTVTATRILKGQQQGHLGPETPLAMDRFPHMALSKTYNTDKQVPDSAGTGTAFL
CGVKTNMKVIGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTY
AHTVNRNWYSDAHMSTAALQEGCKDIAMQLISNTDIDVILGGGRKFMFPKGTPDQEYPTD
PQQAGTRLDGRNLVQEWLAKHQGAQYVWNRTELIQASLNRSVTHLMGLFEPNDMKYNIDR
DPTQDPSLAEMTEVAVHMLSRNPKGFYLFVEGGRIDHGHHEAIAYRALTEAVMFDSAVDK
ADKLTSEKDTMIIVTADHSHVFSFGGYTQREASIFGLAPFKAGDGKSFTSILYGNGPGYK
LNNGIRADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAH
VMAFAGCLEPYTDCGLAPPAGRSSAVSPGYISTLLCLLAGTMLMLMVSAEP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtggggagcctgcttgctgctgctgggcctcagcctacagatgtccctgagc
ctcgtcccagtggaggaggagaacccagcattctggaaccgaaaggcagccgaggccctg
gaggctgccaagaagctgcagcccattcagacgtcagccaacaacctcatcatcctcatg
ggggacgggatgggggtgtccacagtaacggctacccggatactaaagggacagcagcaa
ggccatctgggacctgagacgccactagccatggaccgcttcccacacatggctctgtcc
aaaacatacaacacagacaagcaggtcccggacagcgcaggcacaggcacggcctttctc
tgcggggtcaaaaccaatatgaaggtcattggcttgagtgcagctgcacgctttaatcag
tgcaacacaacgtggggtaatgaggtcgtctcggtaatgcaccgtgctaagaaagcaggg
aagtctgtgggagtggtgaccaccacatcggtgcagcatgcctctccagccggcacctac
gcacacactgtgaaccgtaactggtactccgatgcacacatgtccactgctgcactacag
gagggctgcaaggacatcgccatgcagctcatctccaacaccgacattgatgtgatcctc
ggtggtggccgcaagttcatgtttcctaagggaacaccagaccaggaatatccgactgac
cctcagcaagctggaaccaggctggatggacgcaatctagttcaggagtggctggcaaaa
caccagggtgcccagtatgtttggaaccgcacagagctcatccaggcctccctgaacaga
tctgtgacacacctcatgggcctctttgaacctaatgacatgaaatacaacatcgaccga
gaccctactcaggatccctccctggccgagatgacagaggtggccgtgcacatgctcagc
aggaaccccaaaggcttctatctctttgtggaagggggccgcatcgaccatggtcaccat
gaagctatagcctatcgtgcactgactgaggctgtcatgttcgactcagctgttgacaag
gcagataagctcaccagtgagaaggacacgatgatcattgtcaccgccgaccactctcat
gttttctcttttggtggttacacacagagagaggcctccatttttgggctggctcccttc
aaggctggggatggcaaatcctttacctcgattctatacggcaatggtcctggctacaag
ctcaataatggcatccgggctgatgtcaccgaggaagagagcagcaaccccacgtaccag
cagcaggcggctgtacccctgtcgtcagagacccacagtggggaggacgtggccatattt
gcgcgtggccctcaggcgcacctggtgcacggagtgcaggaacagaactacatcgctcac
gtcatggccttcgcaggctgcctggagccctacaccgactgcggccttgcgccccctgct
ggtcggagcagtgcagtgagtccaggctacatctccaccttgctgtgcctgttggcaggg
acaatgttgatgctgatggtgtcagctgaaccctga

DBGET integrated database retrieval system