KEGG   Rattus norvegicus (rat): 100359982
Entry
100359982         CDS       T01003                                 

Gene name
Mpc2, Brp44, RGD1563422
Definition
(RefSeq) mitochondrial pyruvate carrier 2
  KO
K22139  mitochondrial pyruvate carrier 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    100359982 (Mpc2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    100359982 (Mpc2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    100359982 (Mpc2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC54: Mitochondrial pyruvate carrier
   100359982 (Mpc2)
SSDB
Motif
Pfam: MPC
Other DBs
NCBI-GeneID: 100359982
NCBI-ProteinID: NP_001071111
RGD: 1563422
Ensembl: ENSRNOG00000003150
UniProt: P38718
Position
13q23
AA seq 127 aa
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWKYNQE
LKSKGIQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atggcagctgccggcgcccgaggcctgcgggccacctaccaccgactcatggataaagtg
gagttgttgctgccaaagaaattgaggccgctatacaaccacccggcaggccccagaaca
gtttttttctgggctccgataatgaagtggggattggtatgtgctggattagctgacatg
gccagacctgcagagaaactcagcacagctcaatccactgtgctgatggctacagggttt
atttggtcaaggtattcacttgtaattataccaaaaaattggagtttgttcgctgttaat
ttctttgtggggtcagcaggagcctctcagctgtttcggatctggaaatataatcaagaa
ctcaaatctaaaggaatccagtaa

DBGET integrated database retrieval system