KEGG   Rattus norvegicus (rat): 100360041
Entry
100360041         CDS       T01003                                 

Gene name
Zfp366, Znf366
Definition
(RefSeq) zinc finger protein 366
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf_ZIC zf-C2H2_11 zf-met HypA zf-C2HE PI3K_p85B zf-MIZ
Other DBs
NCBI-GeneID: 100360041
NCBI-ProteinID: XP_008758914
RGD: 2322904
Ensembl: ENSRNOG00000017249
UniProt: D4A715
Position
2q12
AA seq 743 aa
MQKVMKMVKDEDGPLNAAAKSIPSFPHCLQPEASRGKAPQRHPFPEALRGPFSQFRYEPS
PGDLDGFPEVFEGGGSRKRKSMPTKVPYNHSAEEATIAQESKSLGPPNLALLFPQPQHPK
CDSQMIDLCNVGLQFYRTLEHLGGKPVKQEPVKPSAMWPQPTPPAFLPAPYPYYPKVHPG
LMFPFFMPSSSPFPFSRHTFLPKQPPEPVLPRKVEPLESEETKQKVERVDVNVQIDDSYY
VDVGGAQKRWQCPTCDKSYTSKYNLVTHILGHSGIKPHACSRCGKLFKQLSHLHTHMLTH
QGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCSRGFAYPSELKAHEAKHASGR
ENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRPYIC
SECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHLCY
KSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHLHLHSDSKPFKCLYCPSKFT
LKGNLTRHMKVKHGVMERGLHSQGLGRGRLVLAQSTGALRNLEQEEPFDLSQKRSAKGPM
FQSDMDSTQGCLYPEEEEEEEEEADEEDKCYDVEPYSPTLALESQQLCAPEDLSTKQEQA
PKGPGEGCQDQDTPEEPQEDSSEDHESRDIDCEVRDERLSSRLLQSGGQGPSFSDYLYFK
HRDEGLKELLERKMEKQAVLLGI
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgcagaaggtgatgaagatggtcaaagacgaggatggccccctcaacgctgctgcgaaa
agcatcccttcctttccccactgcctacagcccgaggcttcccgagggaaggctccccaa
agacaccccttcccggaagccctccggggccccttttcacagtttcggtatgaaccttct
ccaggagaccttgatggattcccggaggtcttcgagggaggagggtcccggaaacggaag
agcatgcccaccaaggtgccttacaatcactctgcagaagaagccaccatcgctcaggag
agcaagagcttgggtcctccaaacctcgctctgctttttccgcagccacagcatcccaag
tgtgactcccagatgatcgacctgtgcaatgtgggcttgcagttctatcgcaccctggag
cacctggggggcaaaccagtcaagcaggagccggtgaaacccagcgccatgtggccccag
cccacgcctcctgccttcctgcctgcgccttacccctactaccccaaagtccaccctgga
ctcatgtttcccttcttcatgccctcgtcctcacccttccccttcagcaggcacaccttt
ctgcctaagcagccccccgagccagtgttaccccgcaaagtggagcccctggagagcgag
gagaccaaacagaaggtggagagggtggatgtgaacgtccagattgatgacagctactac
gtggatgtgggcggggctcagaagcgctggcagtgccccacctgtgacaagtcctacact
tccaagtataacctggtgacccacatccttggccacagtgggatcaagccgcacgcgtgc
tcccgttgtgggaagctcttcaagcagctcagccatctgcacacccacatgctgacacac
cagggcactcggccccacaaatgccaggtgtgccacaaggccttcacccagaccagccac
ctgaagcgtcacatgatgcagcacagcgaggtgaagccgcacaactgtcgcgtttgcagt
cggggctttgcctaccccagcgagctcaaggcccacgaggccaaacacgccagcgggcgc
gagaacatttgcgtggagtgcggcctcgacttccccaccctggctcagctgaaaaggcac
ctcactacgcatcggggccccatccagtacaactgctcagagtgcgacaagaccttccag
tacccaagccagcttcagaatcacatgatgaagcataaggacatccgtccctacatctgc
tccgagtgcggcatggagttcgtgcaaccccatcacctcaagcaacattcactcacccac
aagggtgtgaaagagcacaagtgcgggatctgtgggcgtgagttcaccctgctggccaac
atgaagagacacgtgctgatccacaccaacatccgtgcctaccagtgtcacctgtgctac
aagagcttcgtgcagaagcagaccctcaaggcacacatgatcgtccactctgatgtgaag
cctttcaaatgcaagctgtgcgggaaggaattcaacaggatgcacaacctgatgggccac
ctgcacctgcactcggacagcaagcccttcaagtgtctctactgtcccagtaagttcacg
ctgaaggggaacctgacccgccatatgaaggtcaagcatggcgtgatggagcgaggcctt
cactctcaaggtctgggtaggggacgactcgtcctggcacagtccactggtgcgctgagg
aatctggagcaggaggagccgtttgacctctcccaaaagcgcagtgcaaaggggccaatg
ttccagtccgacatggacagcacgcagggctgcctctacccagaggaggaggaggaagag
gaggaggaggcagatgaagaggacaagtgctatgacgtggagccctatagccccaccctg
gccttggagagccagcagctctgtgcgcctgaggatctgtccaccaagcaagagcaggcc
ccgaaaggccctggagaaggatgccaggatcaggacactccagaagagccgcaggaggac
agtagcgaggaccatgagagtagagacatagactgtgaagtcagagacgagcgactgagc
agcaggctgttgcaaagcggcgggcagggcccctcgttttctgattacttatacttcaag
cacagagatgagggtttaaaagaattactggagaggaaaatggaaaagcaagcagtcctt
ttgggtatctaa

DBGET integrated database retrieval system