KEGG   Rattus norvegicus (rat): 100360077
Entry
100360077         CDS       T01003                                 

Gene name
Znhit1
Definition
(RefSeq) zinc finger, HIT-type containing 1
  KO
K11663  zinc finger HIT domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100360077 (Znhit1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   SRCAP complex
    100360077 (Znhit1)
   SWR1 complex
    100360077 (Znhit1)
SSDB
Motif
Pfam: zf-HIT
Other DBs
NCBI-GeneID: 100360077
NCBI-ProteinID: NP_001258279
RGD: 2322870
Ensembl: ENSRNOG00000001418
UniProt: D3ZNG9
Position
12q12
AA seq 153 aa
MQTARQVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDD
ADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCG
FPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
NT seq 462 nt   +upstreamnt  +downstreamnt
atgcagacggcgagacaagttcgctcccaggaccctggacagcggcgggtgctggaccgg
gcagccaggcagaggcggatcaaccgacagttggaggcattagagaacgacaacttccag
gatgacccccacgccggcctcccccagctgggcaagagactacctcagttcgatgatgat
gcagacacaggaaagaaaaagaagaaaactcgaggcgaccacttcaaacttcgcttccgc
aaaaacttccaggctttgctggaggagcagaacctgagtgcatctgagggccccaactac
ttgacagcctgtgcgggtccgccatctcggccccagcgtcccttctgtgctgtgtgtggc
ttcccatccccgtatacctgtgtaagctgtggtgcccggtattgcacggtgcgctgcctg
ggcacccatcaggagacccggtgtctgaagtggactgtgtaa

DBGET integrated database retrieval system