KEGG   Rattus norvegicus (rat): 100360180
Entry
100360180         CDS       T01003                                 

Gene name
Pgd
Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00030  Pentose phosphate pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rno_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100360180 (Pgd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100360180 (Pgd)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     100360180 (Pgd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     100360180 (Pgd)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH NAD_binding_11 DNA_pol3_beta Sas6_CC F420_oxidored
Other DBs
NCBI-GeneID: 100360180
NCBI-ProteinID: NP_001292364
RGD: 1583832
UniProt: P85968
Position
5
AA seq 483 aa
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLAKEAKGTKVIGAKSLKD
MVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCQDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQAIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQA
SRKLKGPKMVQLEGSKQAFLEDVRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDDCQDSWRRVISTGVQAGIPM
PCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLSKPGEFIHTNWTGHGGSVSSSS
YNA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcccaagctgacattgcactgattggactggctgtcatgggccagaacttaattttg
aacatgaatgatcatgggtttgtggtctgtgctttcaataggaccgtctccaaagttgat
gacttcttggccaaggaggcgaaaggaaccaaagtgattggtgctaagtccttaaaggac
atggtctccaagctgaagaagccccgccgggtcatactgctcgtgaaggctgggcaagca
gtggatgatttcatcgagaaactagtacccttgctggacaccggtgacatcatcattgat
ggaggaaattctgaataccgggatacgacaagaagatgccaggacctcaaggccaagggc
atcttgttcgtggggagtggagtcagtggtggtgaggaaggggctcggtatgggccatcc
ctcatgccaggagggaacaaagaggcctggccccacatcaagacgatcttccaggccatc
gctgcaaaagtaggaaccggagaaccctgctgtgactgggtgggggacgagggggcgggg
cactttgtgaagatggtgcacaacgggatagagtatggtgacatgcagctgatctgcgag
gcttaccacttgatgaaggatgttctgggcatgcggcatgaggagatggctcaggcgttt
gaagactggaacaagacagagctggactcattcctgattgagatcactgctaacattctc
aagttccaggacactgatggcaaagagctcttaccaaagatccgggacagtgcagggcag
aagggcactgggaagtggacggccatctccgcgctggagtacggcatgcctgtcaccctc
atcggagaagctgtctttgctcggtgcttgtcttctctgaaggaggagcgagttcaggcc
agcagaaagctgaagggccccaagatggtccagctagaaggcagtaagcaggcattcctg
gaggatgtccgtaaggccctttatgcttccaagatcatctcctatgctcaaggctttatg
ctgctcagacaggcagccactgagtttggctggaccctcaattatggtggcattgccctg
atgtggagagggggctgcattatccgaagtgtattcctgggaaaaattaaagatgccttt
gagcgaaacccagaacttcagaacctactgctagatgacttctttaagtcagcagtcgac
gactgccaggactcctggcgccgggtgatcagcaccggggtgcaagcgggcatccccatg
ccctgcttcacaaccgccctctccttctacgatgggtacagacatgagatgctgcccgcc
aacctcatccaggctcaacgggactactttggggcccacacctatgaactcttatccaaa
ccaggagaattcatccacaccaactggacaggccacggtggcagtgtgtcgtcctcttca
tacaatgcctag

DBGET integrated database retrieval system