KEGG   Rattus norvegicus (rat): 100360427
Entry
100360427         CDS       T01003                                 

Gene name
E2f4
Definition
(RefSeq) E2F transcription factor 4
  KO
K04682  transcription factor E2F4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100360427 (E2f4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100360427 (E2f4)
   04218 Cellular senescence
    100360427 (E2f4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100360427 (E2f4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100360427 (E2f4)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP DivIC DUF3584
Other DBs
NCBI-GeneID: 100360427
NCBI-ProteinID: NP_001258274
RGD: 2322129
Ensembl: ENSRNOG00000015708
UniProt: D4A9V4
Position
19q11
AA seq 412 aa
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVW
VQQSIRNVAEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ
IHLKSMSGPIEVLLVNKEAWSSPPVAVPVPPPDDLLQSPPAVSTPPPLPKPALAHPQETS
RPSSPQITTPTPVLGSTEVSDVAGQTAEIAVSGSPGTENKGSGELSSLPLGLTALDTRPL
QSSALLDSSSSSSSSSSSSSSSSSSSGPNPSTSFEPIKADPTGVLDLPKELSEIFDPTRE
CMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLKL
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggaggccgggccacaggcgccgccgcccccgggtactccaagccggcacgagaag
agtctgggacttctcaccaccaagttcgtgtcgcttctgcaggaagccaaggacggcgtg
cttgacctcaagttggcagccgacactcttgctgtacgccagaaacggcggatttacgac
atcaccaacgtgttggaaggtattggtctgatcgagaaaaaatccaagaacagcatccag
tggaagggcgtcgggccaggttgcaatacccgggagattgccgacaaactgattgagctc
aaggcagagatcgaggagctacagcagcgggagcaagaacttgaccagcacaaggtgtgg
gtgcagcagagcatccggaatgtcgcagaggacgtccagaacagctgcttggcctacgtg
actcatgaagacatctgcaggtgctttgctggagataccctccttgctatccgagcccca
tcgggcaccagcctggaggtgcccatcccagagggtctcaatggtcagaagaagtaccag
attcacttaaagagcatgagtggtcccattgaggtcctgctagtgaacaaggaggcctgg
agttcaccacctgtggctgtgcccgtacctccccctgacgatctactccagagcccacct
gctgtgtctacacctccacctctgcccaagcctgccttagctcatccccaagaaacctct
cgtccaagcagcccccagataactacccccactcctgtccttggcagcactgaagtctca
gatgtggcaggccagacagctgagattgcagtgagtggtagccctggaactgagaacaag
ggcagtggtgaactcagttcactcccactgggcctgacagcactggacactcgacctctg
cagtcctctgcactactggatagtagcagcagcagcagcagcagtagcagcagcagcagc
agcagcagcagttcatctggacccaacccttctacctcctttgagcccatcaaggcagac
cccacaggcgttctggatctccccaaagagctgtcagaaatcttcgaccccacaagagag
tgcatgagctccgagctgctggaagaattgatgtcttcagaagtgtttgcccccctcctc
cgactttctccacctcccggagaccacgattacatctacaacctggacgagagtgaaggt
gtctgtgatctctttgatgttcctgttctcaaactctga

DBGET integrated database retrieval system