KEGG   Rattus norvegicus (rat): 100360577Help
Entry
100360577         CDS       T01003                                 

Definition
(RefSeq) homeobox A4-like
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100360577
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    100360577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN DUF2209
Motif
Other DBs
NCBI-GeneID: 100360577
NCBI-ProteinID: XP_002729358
RGD: 2321880
Ensembl: ENSRNOG00000048957 ENSRNOG00000057095
UniProt: E9PT77
Position
4
AA seq 285 aa AA seqDB search
MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAAR
QTPAYYAPRAREPSYHGGLYPAPAAACPYACRGASPARPEQSPAPGAHPSPAPQPPAPPR
RCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNPSYNGGEP
KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHK
LPNTKMRSSNPASAPAGPPGKAQTHSPHPHPHPLPGASTPIPSSI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagctcgtttttgataaactccaactacatcgagcccaagttccctcccttc
gaggagttcgcaccgcacggtggcccgggcggtggggacggcggcgtgggcgggggtccc
ggctacccgcggcctcagagctccccgcacctgccggccccgaacccgcacgcggcccga
cagacccccgcatactacgcgccaagggcgcgcgagcccagctaccacgggggcctgtac
cccgcgcccgccgccgcctgtccctacgcctgtcgcggggccagccccgcgcgacccgag
cagtccccggcccccggcgcgcatcccagcccggccccgcagccccctgcgccccctcgg
cgctgcgctccgggccccaccaccccggctgtcgcgacggggggcagcgcccccgcgtgc
ccgctgctgctggcggaccagggccccgcgggcccgaagggcaaggagccggtggtgtac
ccctggatgaagaagatccacgtgagcgccgtcaaccccagttataacggaggtgagccc
aagcgctctcgaaccgcctatacccggcagcaagtcttggagctggagaaggaattccac
tttaaccgatacctgacccggcgccgccgcatcgagatcgctcacacgctctgcttgtcc
gagcgccaggtcaagatctggttccagaaccggagaatgaagtggaagaaagaccacaaa
cttcccaacaccaagatgcgatcttccaaccctgcctcggcccctgccggcccgcctggg
aaagcacaaactcacagcccacacccccatccccaccctctccccggtgcttccacaccc
attccctcgtctatataa

DBGET integrated database retrieval system