KEGG   Rattus norvegicus (rat): 100360846Help
Entry
100360846         CDS       T01003                                 

Definition
(RefSeq) proteasome subunit beta type 6-like
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100360846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    100360846
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    100360846
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100360846
Peptidases [BR:rno01002]
 Threonine Peptidases
  Family T1: proteasome family
   100360846
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    100360846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-GeneID: 100360846
NCBI-ProteinID: NP_001316812
RGD: 2321312
UniProt: P28073 A0A0G2JSL0
Position
2q23
AA seq 238 aa AA seqDB search
MAAALAVRGAISAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtggagccatctctgcaccggcctttgggccggaggcg
ctcactccagactgggaaaaccgagaagtctccacagggaccacgatcatggctgtgcaa
tttgacgggggcgtggttctaggagcagactccagaacaaccactgggtcgtacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcggcagctgatacccaagcagtagctgatgctgtcacgtaccagcttggtttccacagt
attgagctgaacgagcctccactagtgcacacagccgccagtctctttaaggagatgtgt
taccgctacagagaagatctgatggcaggaatcatcatcgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatgggaggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcatatatctatggctatgttgatgctacctatcgggaaggcatg
accaaggatgaatgtctgcaattcactgccaatgctcttgctttggctatggaacgggat
ggctccagtggaggagtgatccgcttggcagccattcaacagtcgggggtagagcggcag
gtgcttttgggagaccagatccccaaggtcaccatctccactttgccacctccctga

DBGET integrated database retrieval system