KEGG   Rattus norvegicus (rat): 100360846
Entry
100360846         CDS       T01003                                 

Definition
(RefSeq) proteasome subunit beta type 6-like
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100360846
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100360846
   05012 Parkinson disease
    100360846
   05014 Amyotrophic lateral sclerosis
    100360846
   05016 Huntington disease
    100360846
   05017 Spinocerebellar ataxia
    100360846
   05020 Prion disease
    100360846
   05022 Pathways of neurodegeneration - multiple diseases
    100360846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    100360846
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    100360846
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100360846
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   100360846
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    100360846
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 100360846
NCBI-ProteinID: NP_001316812
RGD: 2321312
UniProt: P28073 A0A0G2JSL0
Position
2q23
AA seq 238 aa
MAAALAVRGAISAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtggagccatctctgcaccggcctttgggccggaggcg
ctcactccagactgggaaaaccgagaagtctccacagggaccacgatcatggctgtgcaa
tttgacgggggcgtggttctaggagcagactccagaacaaccactgggtcgtacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcggcagctgatacccaagcagtagctgatgctgtcacgtaccagcttggtttccacagt
attgagctgaacgagcctccactagtgcacacagccgccagtctctttaaggagatgtgt
taccgctacagagaagatctgatggcaggaatcatcatcgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatgggaggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcatatatctatggctatgttgatgctacctatcgggaaggcatg
accaaggatgaatgtctgcaattcactgccaatgctcttgctttggctatggaacgggat
ggctccagtggaggagtgatccgcttggcagccattcaacagtcgggggtagagcggcag
gtgcttttgggagaccagatccccaaggtcaccatctccactttgccacctccctga

DBGET integrated database retrieval system