KEGG   Rattus norvegicus (rat): 100360846
Entry
100360846         CDS       T01003                                 

Definition
(RefSeq) uncharacterized protein LOC100360846
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100360846
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100360846
   05012 Parkinson disease
    100360846
   05014 Amyotrophic lateral sclerosis
    100360846
   05016 Huntington disease
    100360846
   05017 Spinocerebellar ataxia
    100360846
   05020 Prion disease
    100360846
   05022 Pathways of neurodegeneration - multiple diseases
    100360846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    100360846
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    100360846
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100360846
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   100360846
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    100360846
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 100360846
NCBI-ProteinID: NP_001316812
RGD: 2321312
UniProt: P28073 A0A0G2JSL0
Position
2
AA seq 238 aa
MAAALAVRGAISAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtggagccatctctgcaccggcctttgggccggaggcg
ctcactccagactgggaaaaccgagaagtctccacagggaccacgatcatggctgtgcaa
tttgacgggggcgtggttctaggagcagactccagaacaaccactgggtcgtacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcggcagctgatacccaagcagtagctgatgctgtcacgtaccagcttggtttccacagt
attgagctgaacgagcctccactagtgcacacagccgccagtctctttaaggagatgtgt
taccgctacagagaagatctgatggcaggaatcatcatcgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatgggaggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcatatatctatggctatgttgatgctacctatcgggaaggcatg
accaaggatgaatgtctgcaattcactgccaatgctcttgctttggctatggaacgggat
ggctccagtggaggagtgatccgcttggcagccattcaacagtcgggggtagagcggcag
gtgcttttgggagaccagatccccaaggtcaccatctccactttgccacctccctga

KEGG   Rattus norvegicus (rat): 29425
Entry
29425             CDS       T01003                                 

Gene name
Psmb5
Definition
(RefSeq) proteasome subunit beta type-5
  KO
K02737  20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29425 (Psmb5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29425 (Psmb5)
   05012 Parkinson disease
    29425 (Psmb5)
   05014 Amyotrophic lateral sclerosis
    29425 (Psmb5)
   05016 Huntington disease
    29425 (Psmb5)
   05017 Spinocerebellar ataxia
    29425 (Psmb5)
   05020 Prion disease
    29425 (Psmb5)
   05022 Pathways of neurodegeneration - multiple diseases
    29425 (Psmb5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29425 (Psmb5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29425 (Psmb5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29425 (Psmb5)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29425 (Psmb5)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29425 (Psmb5)
SSDB
Motif
Pfam: Proteasome DUF3991
Other DBs
NCBI-GeneID: 29425
NCBI-ProteinID: NP_001099197
RGD: 61879
Ensembl: ENSRNOG00000013386
UniProt: P28075 G3V7Q6
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
15
AA seq 263 aa
MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGT
TTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHDKYTSSIP
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgctggccagcgtgttgcagcggccgatgccggtgaatcagcacgggttttttgga
ctcggaggtcgtgcagatctgctggacttgggtccggggagtcctggtgatgggctgagc
ctagccgcgccgagctggggtgtcccggaggagccacgaatcgaaatgcttcatggaacc
accaccctggccttcaagtttcagcatggagtcattgttgcagcggattcccgggccacc
gcaggtgcctacattgcttcccagacagtgaagaaagtgatagagatcaacccttacctt
ctgggcaccatggctgggggtgcagcggattgcagcttctgggagcggttgttggctcga
cagtgtcgaatctatgagcttcgcaacaaggaacgcatctcggtcgcggcggcctccaaa
ctgcttgccaacatggtgtatcagtacaaaggcatggggctgtccatgggcaccatgatc
tgtggctgggataagagaggcccgggcctctactatgtagacagtgaggggaacaggatc
tctggaaccgccttctcagtgggatctggctccgtgtatgcgtttggagtcatggatcga
ggctactcctatgacctacaagtggaggaggcctatgacctggcccgccgagccatctac
caagccacctacagagatgcctactccggaggagcagtcaacctctaccatgtgcgggag
gatggctggatccgtgtctccagtgacaatgtagctgacttacatgacaagtatacttca
tctatcccctga

KEGG   Rattus norvegicus (rat): 29666
Entry
29666             CDS       T01003                                 

Gene name
Psmb6
Definition
(RefSeq) proteasome subunit beta type-6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29666 (Psmb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29666 (Psmb6)
   05012 Parkinson disease
    29666 (Psmb6)
   05014 Amyotrophic lateral sclerosis
    29666 (Psmb6)
   05016 Huntington disease
    29666 (Psmb6)
   05017 Spinocerebellar ataxia
    29666 (Psmb6)
   05020 Prion disease
    29666 (Psmb6)
   05022 Pathways of neurodegeneration - multiple diseases
    29666 (Psmb6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29666 (Psmb6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29666 (Psmb6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29666 (Psmb6)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29666 (Psmb6)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29666 (Psmb6)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 29666
NCBI-ProteinID: NP_476440
RGD: 61881
Ensembl: ENSRNOG00000019551
UniProt: P28073
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 238 aa
MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtggagccgtctctgcaccggcctttgggccggaggcg
ctcactccagactgggaaaaccgagaagtctccacagggaccacgatcatggctgtgcaa
tttgacgggggcgtggttctaggagcagactccagaacaaccactgggtcgtacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcggcagctgatacccaagcagtagctgatgctgtcacgtaccagcttggtttccacagt
attgagctgaacgagcctccactagtgcacacagctgccagtctctttaaggagatgtgt
taccgctacagagaagatctgatggcaggaatcatcatcgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatgggaggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcatatatctatggctatgttgatgctacctatcgggaaggcatg
accaaggatgaatgtctgcaattcactgccaatgctcttgctttggctatggaacgggat
ggctccagtggaggagtgatccgcttggcagccattcaacagtcgggggtagagcggcag
gtgcttttgggagaccagatccccaaggtcaccatctccactttgccacctccctga

KEGG   Rattus norvegicus (rat): 29668
Entry
29668             CDS       T01003                                 

Gene name
Psma1
Definition
(RefSeq) proteasome subunit alpha type-1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29668 (Psma1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29668 (Psma1)
   05012 Parkinson disease
    29668 (Psma1)
   05014 Amyotrophic lateral sclerosis
    29668 (Psma1)
   05016 Huntington disease
    29668 (Psma1)
   05017 Spinocerebellar ataxia
    29668 (Psma1)
   05020 Prion disease
    29668 (Psma1)
   05022 Pathways of neurodegeneration - multiple diseases
    29668 (Psma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29668 (Psma1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29668 (Psma1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29668 (Psma1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29668 (Psma1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29668 (Psma1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29668 (Psma1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29668 (Psma1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29668
NCBI-ProteinID: NP_058974
RGD: 61841
Ensembl: ENSRNOG00000011745
UniProt: P18420
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
QCNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAADEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgcaaccagtatgacaacgatgtcactgtttggagccctcagggcaggattcat
caaatcgaatatgcaatggaagctgtaaagcaaggctcagcgacagtcggcctgaagtcg
aagacacatgcagtgctggtcgcgctgaagagagcacagtcagagcttgccgctcaccag
aagaaaattctccacgttgacaaccatattggtatctcaattgcgggtctaactgctgat
gccagactgttatgtaactttatgcgccaggagtgtttggattccagatttgtatttgac
agaccacttcccgtatctcgccttgtgtctctaattggaagcaagacccagataccaaca
cagcgatatggccggagaccgtatggtgttgggctgctcattgctggttatgatgacatg
ggccctcacgttttccaaacctgcccatctgctaactattttgactgcagagctatgtcc
atcggagcccgttcccagtcagctcgcacttacctggagagacacatgtctgaatttatg
cagtgcaatttggatgaactggttaagcatggtcttcgcgccttaagagaaacactccct
gcagaacaggacctgaccacaaagaatgtttccattgggattgttggtaaagacttggaa
tttactatctatgatgatgatgatgtgtctccattcctggatggtcttgaagaaagacca
cagagaaaagcacagccttcacaggctgctgatgaacctgcagaaaaagctgatgaacca
atggaacattaa

KEGG   Rattus norvegicus (rat): 29669
Entry
29669             CDS       T01003                                 

Gene name
Psma2
Definition
(RefSeq) proteasome subunit alpha type-2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29669 (Psma2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29669 (Psma2)
   05012 Parkinson disease
    29669 (Psma2)
   05014 Amyotrophic lateral sclerosis
    29669 (Psma2)
   05016 Huntington disease
    29669 (Psma2)
   05017 Spinocerebellar ataxia
    29669 (Psma2)
   05020 Prion disease
    29669 (Psma2)
   05022 Pathways of neurodegeneration - multiple diseases
    29669 (Psma2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29669 (Psma2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29669 (Psma2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29669 (Psma2)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29669 (Psma2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29669 (Psma2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29669
NCBI-ProteinID: NP_058975
RGD: 61842
Ensembl: ENSRNOG00000049920
UniProt: P17220
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
17
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcagaacgcggttacagcttctcgctgactacattcagcccatctggtaaacttgtg
cagattgaatatgctttggccgctgtagctggaggggccccttcagtgggaattaaagct
gcaaatggcgtggtattagccactgagaaaaagcagaaatccatcctgtatgatgagagg
agtgtacacaaagtggagcccataaccaagcacatcggtttggtgtacagcggcatgggt
ccagattacagagtccttgtacacagagctcggaaacttgctcagcagtactaccttgtt
taccaagaacccattcccacagcccaactggtacagcgagtagcgtctgtgatgcaagag
tatacccagtcaggtggtgttcgtccatttggtgtttctttacttatttgtgggtggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaggcc
acagcaatgggaaagaactacgtgaatgggaaaactttccttgagaaaagatataatgaa
gacttagaactggaagatgccattcacacagccatcttaacccttaaggaaagctttgaa
gggcagatgacagaagataacatagaagttgggatctgcaatgaagctggctttaggagg
ctcaccccaactgaagtgagggattacttggctgctatagcgtaa

KEGG   Rattus norvegicus (rat): 29670
Entry
29670             CDS       T01003                                 

Gene name
Psma3
Definition
(RefSeq) proteasome subunit alpha type-3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29670 (Psma3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29670 (Psma3)
   05012 Parkinson disease
    29670 (Psma3)
   05014 Amyotrophic lateral sclerosis
    29670 (Psma3)
   05016 Huntington disease
    29670 (Psma3)
   05017 Spinocerebellar ataxia
    29670 (Psma3)
   05020 Prion disease
    29670 (Psma3)
   05022 Pathways of neurodegeneration - multiple diseases
    29670 (Psma3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29670 (Psma3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29670 (Psma3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29670 (Psma3)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29670 (Psma3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29670 (Psma3)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29670
NCBI-ProteinID: NP_058976
RGD: 61844
Ensembl: ENSRNOG00000007851
Vega: OTTRNOG00000001114
UniProt: P18422
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
6
AA seq 255 aa
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctccattggcactgggtatgacctgtcagcctctacattctctcctgatggaaga
gttttccaagttgaatatgctatgaaggctgtggaaaacagtagtacagctattgggatc
agatgtaaagatggtgttgtgtttggggtagaaaaactagtcctttctaaactttatgaa
gaaggctccaataaacgtcttttcaatgttgatcgacatgttggaatggcagtggcaggt
ttgttggcagatgctcgttccttggcagacatagcaagagaagaagcgtccaactttagg
tctaactttggctataacattcctctaaaacatcttgcagacagagtggccatgtatgta
cacgcgtatacactctacagtgctgttagaccttttggctgcagtttcatgttggggtct
tacagtgtgaatgatggtgcacagctctatatgatcgatccatcaggtgtttcatatggt
tactggggctgtgccattggcaaagccaggcaagctgcaaagacagaaatagaaaagctt
cagatgaaggaaatgacctgccgtgatgtagttaaagaagttgcaaaaataatttacata
gtacatgatgaagttaaggataaagcttttgaactagagctcagctgggttggtgaatta
actaaaggaagacatgaaattgttcccaaagacgtaagagaggaagcagagaaatatgcc
aaggaatctttgaaggaagaagatgaatcagatgacgacaatatgtaa

KEGG   Rattus norvegicus (rat): 29671
Entry
29671             CDS       T01003                                 

Gene name
Psma4
Definition
(RefSeq) proteasome subunit alpha type-4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29671 (Psma4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29671 (Psma4)
   05012 Parkinson disease
    29671 (Psma4)
   05014 Amyotrophic lateral sclerosis
    29671 (Psma4)
   05016 Huntington disease
    29671 (Psma4)
   05017 Spinocerebellar ataxia
    29671 (Psma4)
   05020 Prion disease
    29671 (Psma4)
   05022 Pathways of neurodegeneration - multiple diseases
    29671 (Psma4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29671 (Psma4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29671 (Psma4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29671 (Psma4)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29671 (Psma4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29671 (Psma4)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N DsrH TRP_N
Other DBs
NCBI-GeneID: 29671
NCBI-ProteinID: NP_058977
RGD: 61846
Ensembl: ENSRNOG00000013493
Vega: OTTRNOG00000002260
UniProt: P21670
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
8
AA seq 261 aa
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctcgaagatatgactccaggaccacaatattttctccagaaggtcgcttataccaa
gtggaatatgccatggaagccattggacacgcaggcacttgtttgggaattttagccaat
gatggcgttctgcttgcagcagagaggcgcaacatccacaagcttcttgatgaagtcttt
ttttctgagaaaatttataaacttaacgaggacatggcttgcagtgtggcaggcataaca
tctgatgccaacgttctgactaatgaactcaggctcattgctcaaaggtacttattacag
tatcaggagccaattccctgtgagcagttggttacagcactgtgtgatatcaaacaggcg
tacacacagtttggaggcaaacgtccctttggtgtttctttgctgtatattggctgggat
aagcactatggctttcagctctatcagagtgacccaagtggaaactacgggggatggaaa
gccacatgcattggaaacaacagtgctgcagcggtatcaatgctgaaacaagactacaaa
gaaggagaaatgactctgaagtcagcgctggctctggctgtcaaggtgctaaacaagaca
atggatgttagtaaactgtcagctgaaaaagtggaaatcgccacactaacaagagagaat
ggaaagaccgtgatcagagtcctcaagcaaaaggaagtggaacagttgatcaaaaaacat
gaagaggaagaagcgaaagctgaacgggagaagaaagaaaaagaacagagagaaaaggat
aaatag

KEGG   Rattus norvegicus (rat): 29672
Entry
29672             CDS       T01003                                 

Gene name
Psma5
Definition
(RefSeq) proteasome subunit alpha type-5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29672 (Psma5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29672 (Psma5)
   05012 Parkinson disease
    29672 (Psma5)
   05014 Amyotrophic lateral sclerosis
    29672 (Psma5)
   05016 Huntington disease
    29672 (Psma5)
   05017 Spinocerebellar ataxia
    29672 (Psma5)
   05020 Prion disease
    29672 (Psma5)
   05022 Pathways of neurodegeneration - multiple diseases
    29672 (Psma5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29672 (Psma5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29672 (Psma5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29672 (Psma5)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29672 (Psma5)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29672 (Psma5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29672
NCBI-ProteinID: NP_058978
RGD: 61848
Ensembl: ENSRNOG00000019868
UniProt: Q6P9V6
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
2
AA seq 241 aa
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttcctcactcggtccgagtacgacaggggtgtgaacactttttctcctgaaggaaga
ttatttcaagtggaatatgccattgaggccatcaagcttggttctacggccattggcatc
cagacatcagagggtgtatgtctagctgtggagaagagaattacctcgccactaatggag
cctagcagcattgagaaaatcgtagagattgatgctcatataggttgtgccatgagtggg
ctaattgctgatgctaaaactttaattgataaagccagagtggagacacagaaccactgg
ttcacctataatgagacaatgacagttgagagtgtgacccaggctgtgtccaatctggct
ttgcagttcggagaagaagatgcagatccaggtgctatgtctcgtccctttggagtagca
ttgttgtttggaggagttgatgagaaagggccccaactgtttcacatggacccatctggg
accttcgtacagtgtgatgctcgagcaattggttctgcgtcagagggtgcccagagctcc
ttgcaggaagtttaccacaagtctatgactctgaaggaggccatcaagtcttcactcatc
atcctcaagcaagtcatggaggagaagctgaacgcaactaacatcgagctggccacagtg
cagcctggtcagaatttccacatgttcacaaaggaagaactggaggaggtgatcaaggac
atttaa

KEGG   Rattus norvegicus (rat): 29673
Entry
29673             CDS       T01003                                 

Gene name
Psma6
Definition
(RefSeq) proteasome subunit alpha type-6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29673 (Psma6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29673 (Psma6)
   05012 Parkinson disease
    29673 (Psma6)
   05014 Amyotrophic lateral sclerosis
    29673 (Psma6)
   05016 Huntington disease
    29673 (Psma6)
   05017 Spinocerebellar ataxia
    29673 (Psma6)
   05020 Prion disease
    29673 (Psma6)
   05022 Pathways of neurodegeneration - multiple diseases
    29673 (Psma6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29673 (Psma6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29673 (Psma6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29673 (Psma6)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29673 (Psma6)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29673 (Psma6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29673
NCBI-ProteinID: NP_058979
RGD: 61849
Ensembl: ENSRNOG00000007114
UniProt: P60901
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
6
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccgtggttccagcgccggttttgaccggcacattactattttctctcccgagggc
cgactctaccaagtagaatatgcttttaaggctattaaccagggtggacttacatctgta
gctgtcagaggaaaggactgcgcagttattgtcacacagaagaaagtacctgacaaacta
ctggattccagcaccgtgactcacttattcaagataacggaaaacattggctgtgtgatg
acaggaatgacagctgacagcagatcccaggtacagagggcacgctatgaagcagctaac
tggaaatacaaatatggctatgagattcctgtggacatgctgtgtaaaagaattgctgat
atttctcaagtctacacacagaatgctgaaatgaggccacttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaagtgtacaagtgtgatcctgcaggctactac
tgtggctttaaagccaccgcagcaggagtgaagcagacagagtcaaccagcttcctcgaa
aaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaatcaca
tgcctgtctactgttctgtcgattgatttcaaaccttcagaaatcgaagttggagtagtt
acagttgaaaatcctaaattcaggattcttacagaagcagagattgacgctcaccttgtg
gctctagcagagagagactga

KEGG   Rattus norvegicus (rat): 29674
Entry
29674             CDS       T01003                                 

Gene name
Psma7
Definition
(RefSeq) proteasome subunit alpha type-7
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29674 (Psma7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29674 (Psma7)
   05012 Parkinson disease
    29674 (Psma7)
   05014 Amyotrophic lateral sclerosis
    29674 (Psma7)
   05016 Huntington disease
    29674 (Psma7)
   05017 Spinocerebellar ataxia
    29674 (Psma7)
   05020 Prion disease
    29674 (Psma7)
   05022 Pathways of neurodegeneration - multiple diseases
    29674 (Psma7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29674 (Psma7)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29674 (Psma7)
   03051 Proteasome [BR:rno03051]
    29674 (Psma7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29674 (Psma7)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29674 (Psma7)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    29674 (Psma7)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29674 (Psma7)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N DUF1192
Other DBs
NCBI-GeneID: 29674
NCBI-ProteinID: NP_001008218
RGD: 61851
Ensembl: ENSRNOG00000056853
UniProt: A0A0G2K0W9
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
3
AA seq 248 aa
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILSPEEIEKYVAEIEKEKEENE
KKKQKKAS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagctacgaccgcgccatcaccgtcttctcgcccgacggccacctcttccaagtggag
tacgcgcaggaggcggtcaagaagggctccaccgcggttggtgttcgaggaagggacatt
gttgttcttggtgtggaaaagaagtcggtggccaagctacaagatgaaagaacggtccgg
aaaatctgtgctctggacgataatgtctgcatggcctttgcaggtctcactgccgatgca
aggatagtcatcaacagagccagggtagagtgccagagccaccggctgaccgtggaggac
ccagtgactgtggagtacatcacccgctacattgccagtctgaagcagcgttacacacag
agcaatgggcgcaggccatttggtatctctgccctaattgtgggtttcgacttcgatggc
acccccagactctatcagactgacccctcaggcacataccatgcttggaaggccaatgcc
ataggccggggtgccaagtcggtgcgtgaatttctggagaagaactacacagatgatgcc
attgaaacagacgatctgaccatcaaactggtgatcaaggcgctgctggaagtggtccag
tcaggtggcaaaaacattgaacttgctgtcatgaggcgggatcagcccctcaagattcta
agtcctgaagaaattgagaagtatgttgctgaaatcgagaaggagaaagaagaaaatgaa
aagaagaagcagaagaaagcatcttga

KEGG   Rattus norvegicus (rat): 29675
Entry
29675             CDS       T01003                                 

Gene name
Psmb2
Definition
(RefSeq) proteasome subunit beta type-2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29675 (Psmb2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29675 (Psmb2)
   05012 Parkinson disease
    29675 (Psmb2)
   05014 Amyotrophic lateral sclerosis
    29675 (Psmb2)
   05016 Huntington disease
    29675 (Psmb2)
   05017 Spinocerebellar ataxia
    29675 (Psmb2)
   05020 Prion disease
    29675 (Psmb2)
   05022 Pathways of neurodegeneration - multiple diseases
    29675 (Psmb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29675 (Psmb2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29675 (Psmb2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29675 (Psmb2)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29675 (Psmb2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29675 (Psmb2)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 29675
NCBI-ProteinID: NP_058980
RGD: 61874
Ensembl: ENSRNOG00000011463
UniProt: P40307
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
5
AA seq 201 aa
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RVIDKDGIHNLENITFTKRSS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagtacctcattggcatccagggtcctgactatgtcctggtcgcttctgatcgggtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aaaatcttactcctatgtgttggagaggctggagacactgtacagtttgcagaatatatc
cagaaaaacgtgcagctttataaaatgcggaatggatatgaattgtcccccacagcagca
gctaatttcacacgccgaaacctggccgactgtcttcggagtcggaccccttatcatgtg
aacctcctcctggctggctatgacgagcatgaggggccagcactttactacatggactac
ctagcagccttggccaaggctccttttgcagctcatggctatggtgccttcctgaccctc
agcatccttgaccgatactacacaccaactatctcacgtgagagggcagtggagcttctt
aggaagtgtctggaggagctccagaagcgcttcatcttgaatctgcccaccttcagcgtt
cgggtcattgacaaagatggcatccacaatctggagaacattaccttcactaagcggagt
tcctaa

KEGG   Rattus norvegicus (rat): 29676
Entry
29676             CDS       T01003                                 

Gene name
Psmb3
Definition
(RefSeq) proteasome subunit beta type-3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29676 (Psmb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29676 (Psmb3)
   05012 Parkinson disease
    29676 (Psmb3)
   05014 Amyotrophic lateral sclerosis
    29676 (Psmb3)
   05016 Huntington disease
    29676 (Psmb3)
   05017 Spinocerebellar ataxia
    29676 (Psmb3)
   05020 Prion disease
    29676 (Psmb3)
   05022 Pathways of neurodegeneration - multiple diseases
    29676 (Psmb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29676 (Psmb3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29676 (Psmb3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29676 (Psmb3)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29676 (Psmb3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29676 (Psmb3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 29676
NCBI-ProteinID: NP_058981
RGD: 61875
Ensembl: ENSRNOG00000052730
UniProt: P40112
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 205 aa
MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctgttatgtcctataatggaggggccgtcatggccatgaagggaaagaactgtgtg
gccatcgctgcagacaggcgtttcggaatccaggcccaaatggtgaccacggacttccag
aagatctttcccatgggtgacaggctctacataggcctggccggcctggccactgacgtc
cagacagttgcccagcgtctcaagttccgactgaacctgtacgagctgaaggaaggacgg
cagatcaagccttacaccctgatgagcatggtggccaacctcttgtatgagaaacggttt
ggtccctactacacagaacctgtcattgctggcttggacccgaagacctttaagcccttc
atttgctctctggacctcattggctgtcccatggtgacagatgacttcgtagtcagtggc
acctgctctgaacaaatgtatgggatgtgtgagtctctctgggagcccaacatggatcca
gagcacctgtttgagaccatttctcaggccatgctgaatgctgtggacagggatgccgtg
tcgggcatgggcgtcattgtccacatcattgaaaaagacaagatcaccaccaggacactg
aaggcgcggatggactaa

KEGG   Rattus norvegicus (rat): 364814
Entry
364814            CDS       T01003                                 

Gene name
Psma8
Definition
(RefSeq) proteasome subunit alpha type-7-like
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    364814 (Psma8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    364814 (Psma8)
   05012 Parkinson disease
    364814 (Psma8)
   05014 Amyotrophic lateral sclerosis
    364814 (Psma8)
   05016 Huntington disease
    364814 (Psma8)
   05017 Spinocerebellar ataxia
    364814 (Psma8)
   05020 Prion disease
    364814 (Psma8)
   05022 Pathways of neurodegeneration - multiple diseases
    364814 (Psma8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    364814 (Psma8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    364814 (Psma8)
   03051 Proteasome [BR:rno03051]
    364814 (Psma8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     364814 (Psma8)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   364814 (Psma8)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    364814 (Psma8)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    364814 (Psma8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 364814
NCBI-ProteinID: NP_001102354
RGD: 1311659
Ensembl: ENSRNOG00000030363
UniProt: F1M6I7
Position
18
AA seq 250 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKY
TQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTE
DAISNDNEAIKLAIKALLEVVQSGGKNIELAIIRRDQPLKMFSAKEIELEVTEIEREKDE
AEKKKSKKST
NT seq 753 nt   +upstreamnt  +downstreamnt
atggcttctcggtatgacagggcaatcactgtcttctccccggatggacaccttttccaa
gtggagtatgcccaggaagcagtgaagaaaggctccaccgcggttggaattcgaggaact
aatatagttgtgctcggagtagaaaaaaagtcagtggccaagcttcaagatgaaaggact
gtgaggaaaatctgcgccctcgatgaccatgtctgcatggccttcgcaggtctgacagct
gacgccagagtagtgatcagcagagcgcgggtggagtgccagagccacaagctcacggtg
gaggaccctgtcaccgtagagtatataactcgcttcatagcgactctaaagcagaaatat
acccagagcaatggacgaaggccttttggtatttcagccttaattgtaggctttgatgat
gatggtatcccaagattgtatcagacagatccctccggtacttaccacgcttggaaagca
aatgcaataggccggagtgctaaaactgttcgggaatttctagaaaaaaattacacagaa
gatgcaatttcaaatgacaacgaagctatcaaactagcaataaaagctttgcttgaagtt
gtgcagtctggcggaaagaacattgaactggctatcataagaagagaccaacctttgaag
atgtttagtgccaaagaaattgaattggaggtaactgaaatagaaagggaaaaggacgaa
gcagaaaagaaaaagtcaaagaagtcaacctga

KEGG   Rattus norvegicus (rat): 58854
Entry
58854             CDS       T01003                                 

Gene name
Psmb4
Definition
(RefSeq) proteasome subunit beta type-4
  KO
K02736  20S proteasome subunit beta 7 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    58854 (Psmb4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    58854 (Psmb4)
   05012 Parkinson disease
    58854 (Psmb4)
   05014 Amyotrophic lateral sclerosis
    58854 (Psmb4)
   05016 Huntington disease
    58854 (Psmb4)
   05017 Spinocerebellar ataxia
    58854 (Psmb4)
   05020 Prion disease
    58854 (Psmb4)
   05022 Pathways of neurodegeneration - multiple diseases
    58854 (Psmb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    58854 (Psmb4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    58854 (Psmb4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     58854 (Psmb4)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   58854 (Psmb4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    58854 (Psmb4)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 58854
NCBI-ProteinID: NP_113817
RGD: 61877
Ensembl: ENSRNOG00000020979
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
2
AA seq 264 aa
MEAFWESRTGHWAGGPAPGQFYRVPSTPSCLMDPMSAPCEGPITRTQNPMVTGTSVLGVK
FDCGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYAGGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQVATVTEK
GVEIEGPLSAQTNWDIAHMISGFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaagcgttttgggagtcacggactggccactgggccgggggtccggctccggggcag
ttttaccgcgtcccgtccacccccagctgcctcatggatccgatgtctgcgccctgcgag
ggtcccatcactcggacccagaaccccatggtgactgggacatccgtactaggggtgaag
ttcgactgcggagtggtgattgctgcagacatgctgggctcctacggctccctggctcgt
ttccgcaatatctctcgtattatgcgagtcaacgacagcactatgctaggtgcttcagga
gactatgctgatttccagtatttgaagcaagttctcggccagatggtgattgatgaggag
ctgttgggagatggacatagctatagtcctagagctatccattcatggttgacaagggcc
atgtacagtcgccgctccaagatgaaccctctgtggaacaccatggtcattggaggctat
gctggtggagaaagctttcttggttatgtggacatgcttggtgtagcttatgaagcccct
tcactagccactggttatggtgcatacttggctcagcctctgcttcgagaagttctagag
aagcaaccggtgctgagtcagacagaggcccgagagcttgtggagcgctgcatgcgagtg
ctgtactaccgagacgctcgttcgtataaccggtttcaagttgctactgtaactgaaaaa
ggtgtggagatagaaggaccactgtcagcacagaccaactgggacattgctcacatgatc
agtggctttgaatga

KEGG   Rattus norvegicus (rat): 85492
Entry
85492             CDS       T01003                                 

Gene name
Psmb7
Definition
(RefSeq) proteasome subunit beta type-7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    85492 (Psmb7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85492 (Psmb7)
   05012 Parkinson disease
    85492 (Psmb7)
   05014 Amyotrophic lateral sclerosis
    85492 (Psmb7)
   05016 Huntington disease
    85492 (Psmb7)
   05017 Spinocerebellar ataxia
    85492 (Psmb7)
   05020 Prion disease
    85492 (Psmb7)
   05022 Pathways of neurodegeneration - multiple diseases
    85492 (Psmb7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    85492 (Psmb7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    85492 (Psmb7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     85492 (Psmb7)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   85492 (Psmb7)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    85492 (Psmb7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 85492
NCBI-ProteinID: NP_445984
RGD: 621093
Ensembl: ENSRNOG00000011732
UniProt: Q9JHW0
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
3
AA seq 277 aa
MAAVSVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTPLELEVLEEIVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtttcaggcaccggtcggaggcttttcttttgataattgccgc
aggaatgcggtcttggaagctgattttgcaaaaaaggggttcaaacttccgaaagctcgg
aaaactggcactaccatcgcgggggtggtctataaggatggaatagttcttggagcagac
acgagagcaactgaagggatggttgttgctgacaaaaactgttcaaaaattcacttcata
tctcctaatatttattgctgtggtgctgggacagctgcagacacagacatgacaacccag
cttatttcttctaacttggagctccactctctcaccaccggccgccttcccagagttgtc
acagcgaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtcgatgttactggacctcatctctacagcatctatccgcatgga
tcaactgataaactgccttatgtcaccatgggttctggctccttggcagcaatggctgtg
tttgaagataagtttaggccagatatggaggaggaagaagccaagaagctagtgagtgaa
gctattgcagctggcatctttaatgacttggggtctggaagcaacattgatctgtgtgtt
atcagcaagagcaagctggactttctccgtccatactcagtgcccaacaagaaagggacc
aggtttggccggtacaggtgtgagaaaggcactaccgctgtcctcacggagaaagtcacc
cctctggagctcgaggtgctagaagagattgttcagacaatggacacttcgtga

KEGG   Rattus norvegicus (rat): 94198
Entry
94198             CDS       T01003                                 

Gene name
Psmb1
Definition
(RefSeq) proteasome subunit beta type-1 precursor
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    94198 (Psmb1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    94198 (Psmb1)
   05012 Parkinson disease
    94198 (Psmb1)
   05014 Amyotrophic lateral sclerosis
    94198 (Psmb1)
   05016 Huntington disease
    94198 (Psmb1)
   05017 Spinocerebellar ataxia
    94198 (Psmb1)
   05020 Prion disease
    94198 (Psmb1)
   05022 Pathways of neurodegeneration - multiple diseases
    94198 (Psmb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    94198 (Psmb1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    94198 (Psmb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     94198 (Psmb1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   94198 (Psmb1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    94198 (Psmb1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 94198
NCBI-ProteinID: NP_446042
RGD: 621092
Ensembl: ENSRNOG00000001488
UniProt: P18421
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1
AA seq 240 aa
MLSTAAYRDPDRELVMGPQGSAGPVQMRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGF
SIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS
TILYSRRFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQV
GFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctttccactgccgcttaccgggacccggaccgagagctggtaatggggcctcagggc
tccgccggccctgtgcagatgcgtttctcgccttatgccttcaacggaggtactgtattg
gcaattgctggagaagatttttccatcgttgcttcagacactcggttgagtgaagggttt
tcaattcatacccgagatagccccaaatgttacaaactaacagacaaaacagtaattggc
tgcagtggctttcatggagattgtctcaccttgacaaagattattgaagcaagattaaag
atgtacaagcattccaataacaaggccatgacaacaggggcgattgctgcaatgctgtct
accatcctgtactcacggcgtttcttcccttactatgtctacaacatcattgagggactt
gatgaagaaggaaagggagccgtgtacagctttgacccagtaggctcttaccagagagac
tctttcaaagccggaggctcagcaagtgccatgctgcagccgctgctcgacaaccaggtt
ggcttcaaaaatatgcagaatgtggagcatgtccccctgactctggacagagccatgagg
ctggtgaaagacgtcttcatttctgcagccgagagggatgtgtacactggagacgccctc
aggatctgcatcgtgaccaaagagggcatcagggaggagactgttccccttcggaaagac
tga

DBGET integrated database retrieval system