KEGG   Rattus norvegicus (rat): 100360880
Entry
100360880         CDS       T01003                                 

Gene name
Fosb
Definition
(RefSeq) protein fosB
  KO
K09029  protein FosB
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno04657  IL-17 signaling pathway
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100360880 (Fosb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100360880 (Fosb)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100360880 (Fosb)
   05031 Amphetamine addiction
    100360880 (Fosb)
   05034 Alcoholism
    100360880 (Fosb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100360880 (Fosb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100360880 (Fosb)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4407 DivIC DUF3450 FapA Spc24
Other DBs
NCBI-GeneID: 100360880
NCBI-ProteinID: NP_001243438
RGD: 1308198
Ensembl: ENSRNOG00000046667
UniProt: D3ZLB7
Position
1
AA seq 338 aa
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS
GGPSTSTSTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSY
TSSFVLTCPEVSAFAGSQRTSGSEQPSDPLNSPSLLAL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtttcaagctttccccggagactacgactccggctcccggtgtagctcatcaccctcc
gccgagtctcagtacctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggctccttcgtgccaacggtcaccgca
atcacaaccagccaggaccttcagtggctcgtgcagcccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcctccagctgttgacccttatgacatgcct
ggaaccagctactcaaccccgggcctgagtgcctacagcactggtggggcaagcggaagt
ggtgggccttcaactagcacaagcaccagtggacccgtgtctgcccgcccagccagagcc
aggcctagaagaccccgagaagaaacacttaccccagaagaagaagaaaaacgaagggtt
cgcagagagcggaacaagctggctgcagctaaatgcagaaaccgtcggagggagctgaca
gaccgactccaggcggaaacggatcagctcgaagaggaaaaggcagagctggagtcggag
atcgccgagctgcaaaaagagaaggaacgcctggagtttgtcctggtggcccacaaaccg
ggctgcaagatcccttacgaagaggggccggggccaggcccgctggccgaggtgagagat
ttgccagggtcaacatccgctaaggaagacggcttcggctggctgctgccgccccctcca
ccaccgcccctgcccttccagagcagccgagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttagcccttcgtac
acttcctcgtttgtcctcacctgcccggaggtctccgcgttcgccggctcccaacgcacc
agcggcagcgagcagccgtccgaccccctgaactcgccctcccttcttgctctgtaa

KEGG   Rattus norvegicus (rat): 24516
Entry
24516             CDS       T01003                                 

Gene name
Jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04024  cAMP signaling pathway
rno04137  Mitophagy - animal
rno04210  Apoptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05224  Breast cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24516 (Jun)
   04012 ErbB signaling pathway
    24516 (Jun)
   04310 Wnt signaling pathway
    24516 (Jun)
   04668 TNF signaling pathway
    24516 (Jun)
   04024 cAMP signaling pathway
    24516 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    24516 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    24516 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24516 (Jun)
   04530 Tight junction
    24516 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    24516 (Jun)
   04621 NOD-like receptor signaling pathway
    24516 (Jun)
   04625 C-type lectin receptor signaling pathway
    24516 (Jun)
   04660 T cell receptor signaling pathway
    24516 (Jun)
   04658 Th1 and Th2 cell differentiation
    24516 (Jun)
   04659 Th17 cell differentiation
    24516 (Jun)
   04657 IL-17 signaling pathway
    24516 (Jun)
   04662 B cell receptor signaling pathway
    24516 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    24516 (Jun)
   04915 Estrogen signaling pathway
    24516 (Jun)
   04921 Oxytocin signaling pathway
    24516 (Jun)
   04926 Relaxin signaling pathway
    24516 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24516 (Jun)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24516 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24516 (Jun)
   05203 Viral carcinogenesis
    24516 (Jun)
   05231 Choline metabolism in cancer
    24516 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24516 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24516 (Jun)
   05211 Renal cell carcinoma
    24516 (Jun)
   05224 Breast cancer
    24516 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24516 (Jun)
   05170 Human immunodeficiency virus 1 infection
    24516 (Jun)
   05161 Hepatitis B
    24516 (Jun)
   05171 Coronavirus disease - COVID-19
    24516 (Jun)
   05162 Measles
    24516 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24516 (Jun)
   05169 Epstein-Barr virus infection
    24516 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24516 (Jun)
   05135 Yersinia infection
    24516 (Jun)
   05133 Pertussis
    24516 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    24516 (Jun)
   05142 Chagas disease
    24516 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24516 (Jun)
   05321 Inflammatory bowel disease
    24516 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    24516 (Jun)
   05031 Amphetamine addiction
    24516 (Jun)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24516 (Jun)
   05418 Fluid shear stress and atherosclerosis
    24516 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    24516 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24516 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24516 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24516 (Jun)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    24516 (Jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch TFIIA NBP1 Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 24516
NCBI-ProteinID: NP_068607
RGD: 2943
Ensembl: ENSRNOG00000026293
UniProt: P17325
Position
5
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagtggcgcctacggctacagtaaccctaagattctgaagcagagcatgaccttg
aacctggccgacccggtgggcaatctgaagccgcacctccgagccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccactcagttcttgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgaaggcttcgtgcgcgccctagctgaa
ctgcatagccagaatacgctgcccagtgtcacctccgcggcacaacctgtcagtggggcg
ggcatggtcgctcccgctgtggcctcagtagctggcgctggcggcggcggcggctacagc
gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcgaccgggctggcctttccatcgcag
ccccagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggctgcaggcgctgaaggaagagccgcagacggtgccggagatgccggga
gagacgccgcccttgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagcggatc
gcccggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

KEGG   Rattus norvegicus (rat): 24518
Entry
24518             CDS       T01003                                 

Gene name
Jund
Definition
(RefSeq) transcription factor jun-D isoform JunD-FL
  KO
K04449  transcription factor jun-D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04380  Osteoclast differentiation
rno04657  IL-17 signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24518 (Jund)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    24518 (Jund)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    24518 (Jund)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24518 (Jund)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24518 (Jund)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    24518 (Jund)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB TSC22 DUF3450 Fib_alpha FlaC_arch TEX13 DUF724 PspA_IM30
Other DBs
NCBI-GeneID: 24518
NCBI-ProteinID: NP_620230
RGD: 2945
Ensembl: ENSRNOG00000019568
UniProt: P52909
Position
16
AA seq 341 aa
METPFYGEEALSGLAAGASSVAGAAGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLA
EQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
TQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGAPAPPAPADLAATPGATE
TPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALGPPPPPHPPRLAALKDEPQTV
PDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQ
NTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaaacgcccttctatggcgaggaggcgctgagcggcctggctgcgggtgcgtcgagc
gtcgctggtgctgctggggcccccggcggtggtggcttcgcgcccccgggccgcgctttc
cccggggcgcccccaacgagcagcatgctgaagaaagacgcgctgacgctcagcctggcg
gagcagggagcggcgggattgaaaccagggtcggccactgcaccttctgcattgcgcccc
gacggcgcccccgacgggctgctggcttcgccggatcttgggctgctcaaactcgcgtcg
ccggagctggaaaggctgatcatccagtccaacgggctggtgaccaccaccccgaccagt
acgcagttcctctaccctaaggtggcggccagcgaggagcaggagttcgccgaaggcttc
gtcaaggcgctggaggacctgcacaagcagagccagctgggtgcggccaccgcggccacc
tcaggggctcccgcgccccccgcgcccgcggacctggcagccacccccggggccacggag
accccggtctacgccaacctgagcagtttcgcgggtggcgccgggccccctgggggcgcg
gccacagtggccttcgccgcggagccagtgcccttcccgccgcccccgggcgcgctgggg
ccgccgccacctccgcatccaccgcgtctggccgcgctcaaggacgagccgcagaccgtg
ccggacgtgccgagcttcggcgacagccctccactgtcgcccatcgacatggacacgcag
gaacgcatcaaggcggagcgcaagaggctgcgcaaccgcatcgccgcttccaaatgccgc
aagcgcaagctggagcgtatctcgcgcctggaggagaaagtcaagaccctcaaaagccag
aacaccgagctggcgtccaccgcgagcctgctgcgcgagcaggtggcgcagctcaaacag
aaagtcctcagccacgtcaacagcggctgccagctgctgccccagcaccaggtccccgcg
tattga

KEGG   Rattus norvegicus (rat): 25445
Entry
25445             CDS       T01003                                 

Gene name
Fosl1
Definition
(RefSeq) fos-related antigen 1
  KO
K04502  fos-like antigen 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04657  IL-17 signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25445 (Fosl1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    25445 (Fosl1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25445 (Fosl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25445 (Fosl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25445 (Fosl1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    25445 (Fosl1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin DUF4527 TMCO5 DUF4407
Other DBs
NCBI-GeneID: 25445
NCBI-ProteinID: NP_037085
RGD: 2627
Ensembl: ENSRNOG00000020552
UniProt: P10158
Position
1
AA seq 275 aa
MYRDFGEPGPSSGAGSAYGRPAQPQQAQTQTVQQQKFHLVPSINAVSGSQELQWMVQPHF
LGPSGYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLA
AAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEED
KKDTGGTSSTSGAGSPPGPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFT
YPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgtaccgagacttcggggaaccgggaccgagttccggggctggcagcgcgtacggtcgc
cccgcgcagccccagcaagcgcagacacagacagtccagcagcagaagttccaccttgtg
ccaagcatcaacgctgtcagtggcagccaggaattgcagtggatggtgcagcctcatttc
ctgggacccagcggctatccccgacctctgacctatccccagtacagtccccctcagccc
cgaccaggagtcatacgagccctagggccacctccaggggtgcgacgcaggccctgtgag
cagatcagcccggaggaggaagagcgccgcagggtgagacgagagcggaacaagctagca
gctgctaagtgcagaaaccgaagaaaggaattgacagacttcctgcaggcggagaccgac
aagttggaggatgagaaatcggggctgcagcgtgagatcgaagagctgcagaagcagaag
gaacgccttgagctggtgctggaagcccatcgccccatctgcaaaatcccagaagaagac
aagaaggacacaggtggtaccagcagcacgagtggggcgggtagcccaccgggcccctgc
cgcccagtgccttgtatctccctttctccaggacccgtacttgaaccggaagcactgcat
acccccacgctcatgaccacaccctctctgactccttttactccgagtctggttttcacc
tatcctagcacaccagagccttgttcctcagcccatcgaaagagtagcagcagcagtggt
gacccctcctccgaccccctaggttctcccacactcctggctttgtga

KEGG   Rattus norvegicus (rat): 314322
Entry
314322            CDS       T01003                                 

Gene name
Fos
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04024  cAMP signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04932  Non-alcoholic fatty liver disease
rno04935  Growth hormone synthesis, secretion and action
rno05031  Amphetamine addiction
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05224  Breast cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    314322 (Fos)
   04668 TNF signaling pathway
    314322 (Fos)
   04024 cAMP signaling pathway
    314322 (Fos)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    314322 (Fos)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    314322 (Fos)
   04660 T cell receptor signaling pathway
    314322 (Fos)
   04658 Th1 and Th2 cell differentiation
    314322 (Fos)
   04659 Th17 cell differentiation
    314322 (Fos)
   04657 IL-17 signaling pathway
    314322 (Fos)
   04662 B cell receptor signaling pathway
    314322 (Fos)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    314322 (Fos)
   04917 Prolactin signaling pathway
    314322 (Fos)
   04921 Oxytocin signaling pathway
    314322 (Fos)
   04926 Relaxin signaling pathway
    314322 (Fos)
   04935 Growth hormone synthesis, secretion and action
    314322 (Fos)
   04928 Parathyroid hormone synthesis, secretion and action
    314322 (Fos)
  09156 Nervous system
   04725 Cholinergic synapse
    314322 (Fos)
   04728 Dopaminergic synapse
    314322 (Fos)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    314322 (Fos)
  09159 Environmental adaptation
   04713 Circadian entrainment
    314322 (Fos)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    314322 (Fos)
   05231 Choline metabolism in cancer
    314322 (Fos)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    314322 (Fos)
  09162 Cancer: specific types
   05210 Colorectal cancer
    314322 (Fos)
   05224 Breast cancer
    314322 (Fos)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    314322 (Fos)
   05170 Human immunodeficiency virus 1 infection
    314322 (Fos)
   05161 Hepatitis B
    314322 (Fos)
   05171 Coronavirus disease - COVID-19
    314322 (Fos)
   05162 Measles
    314322 (Fos)
   05167 Kaposi sarcoma-associated herpesvirus infection
    314322 (Fos)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    314322 (Fos)
   05135 Yersinia infection
    314322 (Fos)
   05133 Pertussis
    314322 (Fos)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    314322 (Fos)
   05142 Chagas disease
    314322 (Fos)
  09163 Immune disease
   05323 Rheumatoid arthritis
    314322 (Fos)
  09165 Substance dependence
   05031 Amphetamine addiction
    314322 (Fos)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    314322 (Fos)
   05418 Fluid shear stress and atherosclerosis
    314322 (Fos)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    314322 (Fos)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    314322 (Fos)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314322 (Fos)
   04131 Membrane trafficking [BR:rno04131]
    314322 (Fos)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    314322 (Fos)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    314322 (Fos)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 314322
NCBI-ProteinID: NP_071533
RGD: 2626
Ensembl: ENSRNOG00000008015
UniProt: P12841
Position
6
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFT
LPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYA
ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggtttcaacgcggactacgaggcgtcatcctcccgctgcagtagcgcc
tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg
ggctcccctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt
atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact
ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc
ccgtcgaccggggcttacgccagagcgggagtggtgaagaccatgtcaggcggcagagcg
cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg
agaatccgaagggaaaggaataagatggctgcagccaagtgccggaatcggaggagggag
ctgacagatacgctccaagcggagacagatcaacttgaagacgagaagtctgcgttgcag
accgagattgccaatctactgaaagagaaggaaaaactggagtttattttggcagcccac
cgacctgcctgcaagatccccaatgacctgggcttcccagaggagatgtctgtgacctcc
ctggacttgactgggggtctgcctgaggctaccaccccagagtctgaggaggccttcacc
ctgcctcttctcaatgaccctgagcccaagccatccttggagccggtcaagaacattagc
aacatggagctgaaggctgaaccctttgatgacttcttgtttccggcatcatctaggccc
agtggctcggagactgcccgctctgtgccagatgtggacctgtctggttccttctatgca
gcagactgggagcctctgcacagcagttccctggggatggggcccatggtcacagagctg
gagcccctgtgcactcccgttgtcacctgcactcccagctgcactacctatacgtcttcc
tttgtcttcacctaccccgaggctgactccttccctagctgcgcagctgcccaccgaaag
ggcagcagcagcaacgagccctcctctgactcactgagctcgcccacactgctagccctg
tga

DBGET integrated database retrieval system