KEGG   Rattus norvegicus (rat): 100360977
Entry
100360977         CDS       T01003                                 

Definition
(RefSeq) TRIMCyp-like
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100360977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    100360977
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100360977
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100360977
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100360977
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   100360977
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 100360977
NCBI-ProteinID: XP_006250863
RGD: 2321083
Ensembl: ENSRNOG00000055068
Vega: OTTRNOG00000001781
UniProt: P10111
Position
14p21
AA seq 164 aa
MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL
NT seq 495 nt   +upstreamnt  +downstreamnt
atggtcaaccccaccgtgttcttcgacatcacggctgatggcgagcccttgggtcgcgtc
tgcttcgagctgtttgcagacaaagtgccaaagacagcagaaaactttcgtgctctgagc
actggggagaaaggatttggctataagggttcctcctttcacagaattattccaggattc
atgtgccagggtggtgacttcacacgccataatggcactggtggcaagtccatctacgga
gagaaatttgaggatgagaacttcatcctgaagcatacaggtcctggcatcttgtccatg
gcaaatgctggaccaaacacaaatggttcccagttttttatctgcactgccaagactgag
tggctggatggcaagcatgtggtctttgggaaggtgaaagaaggcatgagcattgtggaa
gccatggagcgttttgggtccaggaatggcaagaccagcaagaagatcaccatctccgac
tgtggacaactctaa

DBGET integrated database retrieval system