KEGG   Rattus norvegicus (rat): 100361126
Entry
100361126         CDS       T01003                                 

Gene name
RGD2320734
Definition
(RefSeq) cytochrome b-c1 complex subunit 9
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100361126 (RGD2320734)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100361126 (RGD2320734)
  09159 Environmental adaptation
   04714 Thermogenesis
    100361126 (RGD2320734)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100361126 (RGD2320734)
   05012 Parkinson disease
    100361126 (RGD2320734)
   05014 Amyotrophic lateral sclerosis
    100361126 (RGD2320734)
   05016 Huntington disease
    100361126 (RGD2320734)
   05020 Prion disease
    100361126 (RGD2320734)
   05022 Pathways of neurodegeneration - multiple diseases
    100361126 (RGD2320734)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100361126 (RGD2320734)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100361126 (RGD2320734)
SSDB
Motif
Pfam: UCR_UQCRX_QCR9
Other DBs
NCBI-GeneID: 100361126
NCBI-ProteinID: XP_038949900
RGD: 2320734
Ensembl: ENSRNOG00000009521
Position
15
AA seq 64 aa
MASPTVASRLYSLLFHRTSTFALTIAVSSLFFERAFDQGADAIYDHSKEGKLWKHIKHKY
ENQE
NT seq 195 nt   +upstreamnt  +downstreamnt
atggcgtcgccgacggtcgcttcgcgtttgtactccttgctgttccacaggacctccacc
ttcgccctcaccatcgcagtgagctccctgttcttcgagcgggccttcgatcagggtgca
gacgcgatctatgatcacagcaaggaggggaaactgtggaaacacataaagcacaagtac
gagaaccaggagtaa

KEGG   Rattus norvegicus (rat): 26192
Entry
26192             CDS       T01003                                 

Gene name
CYTB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00151  Cytochrome bc1 complex respiratory unit
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26192 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    26192 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    26192 (CYTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26192 (CYTB)
   05012 Parkinson disease
    26192 (CYTB)
   05014 Amyotrophic lateral sclerosis
    26192 (CYTB)
   05016 Huntington disease
    26192 (CYTB)
   05020 Prion disease
    26192 (CYTB)
   05022 Pathways of neurodegeneration - multiple diseases
    26192 (CYTB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26192 (CYTB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    26192 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26192 (CYTB)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    26192 (CYTB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Other DBs
NCBI-GeneID: 26192
NCBI-ProteinID: YP_665641
RGD: 620081
UniProt: P00159 Q8HIC4
Position
MT
AA seq 380 aa
MTNIRKSHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQILTGLFLAMHYTSDTM
TAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGLYYGSYTFLETWNIGIILL
FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFA
FHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLFLM
TLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVVALILSILI
LAFLPFLHTSKQRSLTFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFS
IILILMPISGIVEDKMLKWN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacaaacatccgaaaatctcaccccctattcaaaatcatcaaccactcctttatcgac
ctccccgccccatctaacatctcatcatgatgaaacttcggttctctactaggagtatgc
ctcatagtacaaatcctcacaggcttattcctagcaatacactacacgtctgataccata
acagcattttcatcagtcacccacatctgccgagacgtaaactacggctgactaatccga
tacctacacgccaacggcgcctcaatatttttcatctgcctattcctccatgtgggacga
ggactatactatggatcctacactttcctagaaacctgaaacattgggatcattctacta
tttgcagtcatagcaactgcattcatgggctatgtactcccatgaggacaaatatcattc
tgaggagctacagtaattacaaacctattatctgctatcccttacattgggactacccta
gtcgaatgaatctgaggaggcttctcagtagacaaagcaaccctaacacgcttcttcgca
ttccacttcatcctcccattcattatcgccgcccttgcaattgtacatcttcttttcctc
cacgaaacaggatcaaataaccccacaggattaaactccgacgcagacaaaatcccattc
catccatattatacaattaaagacctcctaggtgtatttatattactattattcctaata
accctagtactattcttcccagacctactaggagacccagacaattatacacccgctaac
cccctcaacaccccaccccacatcaaaccagaatgatattttctctttgcctacgctatt
ctacgctccattcccaacaaactaggaggagtcgtagccctaatcttatcaatcctaatc
ttagccttcctaccattcctgcatacttcaaaacaacgcagcttaacattccgcccaatc
acccaaatcctttactgaatcctagtagccaacctcctaatcttaacatgaatcggaggc
caaccagtagaacacccatttatcattattggccaactagcctccatcagctacttttca
attatcctcattctcataccaatctctggaattgttgaagacaaaatgttaaaatgaaat
taa

KEGG   Rattus norvegicus (rat): 291103
Entry
291103            CDS       T01003                                 

Gene name
Uqcrfs1
Definition
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00151  Cytochrome bc1 complex respiratory unit
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291103 (Uqcrfs1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    291103 (Uqcrfs1)
  09159 Environmental adaptation
   04714 Thermogenesis
    291103 (Uqcrfs1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291103 (Uqcrfs1)
   05012 Parkinson disease
    291103 (Uqcrfs1)
   05014 Amyotrophic lateral sclerosis
    291103 (Uqcrfs1)
   05016 Huntington disease
    291103 (Uqcrfs1)
   05020 Prion disease
    291103 (Uqcrfs1)
   05022 Pathways of neurodegeneration - multiple diseases
    291103 (Uqcrfs1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    291103 (Uqcrfs1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    291103 (Uqcrfs1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     291103 (Uqcrfs1)
SSDB
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske
Other DBs
NCBI-GeneID: 291103
NCBI-ProteinID: NP_001008888
RGD: 628838
Ensembl: ENSRNOG00000018281
UniProt: P20788
Position
17
AA seq 274 aa
MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAA
TRPLVATVGLNVPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttgtcggtcgctgcccgctcgggcccgttcgcgcccgtcctatcggccacgtcccgc
ggggtggcgggagcgctgcggcccctgctgcaaagcgcggtgcccgccacctcggaacca
ccggttctggacgtgaagcgacccttcctgtgccgtgagtcgctgagtggccaggccgcg
acccgtcctttggtggccacagtgggcctgaatgttcctgcttctgttcgttattcccac
acagacatcaaggtgcccgacttctctgactatcgccgtgctgaagttctagatagcaca
aaatcttctaaagagagcagtgaggctagaaaaggcttctcttacttggtaactgcaact
actactgtgggtgttgcatacgctgcgaaaaatgcagtctcccagtttgtttccagcatg
agtgcttctgcggatgtactggccatgtcgaagatcgagatcaagttgtctgatattcca
gaggggaagaacatggcttttaaatggagaggcaaacctctgtttgtgcgccatagaacc
aagaaggagattgaccaggaagctgcagttgaagtgtcccagttaagggacccacagcat
gatttagagcgtgtaaagaagcctgaatgggttattctgatcggtgtctgtactcatctt
ggttgtgtacccattgcaaacgcaggagattttggtggctactattgcccctgccatggg
tcacactatgatgcttctggcaggatcaggaagggccctgcacctctcaacctggaagta
cctacctatgagttcaccagtggtgatgtagttgttgtgggttag

KEGG   Rattus norvegicus (rat): 293448
Entry
293448            CDS       T01003                                 

Gene name
Uqcrc2
Definition
(RefSeq) cytochrome b-c1 complex subunit 2, mitochondrial precursor
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293448 (Uqcrc2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    293448 (Uqcrc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    293448 (Uqcrc2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293448 (Uqcrc2)
   05012 Parkinson disease
    293448 (Uqcrc2)
   05014 Amyotrophic lateral sclerosis
    293448 (Uqcrc2)
   05016 Huntington disease
    293448 (Uqcrc2)
   05020 Prion disease
    293448 (Uqcrc2)
   05022 Pathways of neurodegeneration - multiple diseases
    293448 (Uqcrc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293448 (Uqcrc2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293448 (Uqcrc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    293448 (Uqcrc2)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M16: pitrilysin family
   293448 (Uqcrc2)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C DUF1471
Other DBs
NCBI-GeneID: 293448
NCBI-ProteinID: NP_001006971
RGD: 1359150
Ensembl: ENSRNOG00000036742
UniProt: P32551
Position
1
AA seq 452 aa
MKLLSRAGSFSRFYSLKVAPKLKTSAPGGVPLQPQELEFTKLPNGLVIASLENYAPLSRI
GLFIKAGSRYENYNYLGTSHLLRLASTLTTKGASSFKITRGIEAVGGKLSVTATRENMAY
TVEGIRDDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNPQTRIIENLHDVA
YKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSILKEVAEQFLNIR
GGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKR
GNNTTSLLSQSVAKGSQQPFDVSAFNASYSDSGLFGIYTVSQAAAAGDVINAAYNQVKAV
AQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALATGSYMPPPTVLQQIDAVAD
ADVVKAAKKFVSGKKSMTASGNLGHTPFLDEL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaagctcctcagcagggccgggtccttctcgagattttattccctcaaagttgcccca
aagcttaaaacttcagcccctggaggagtgcctctgcagcctcaggaacttgagtttacc
aaattaccaaatggtttggtgattgcttctctggaaaactatgctccactatcaagaatt
ggcttattcattaaagcaggcagtagatatgagaactacaactacttgggaacctctcat
ttactacgtcttgcatctactttgactaccaaaggagcttcatctttcaagatcacccgt
ggaattgaagcagttggtggtaaattaagtgtgactgcaacaagggaaaacatggcatac
actgtagaaggcattcgggatgatattgaaatcctgatggagttcctgctcaatgtcaca
acagcaccagaatttcgccgctgggaagttgctgcccttcggtctcagctaaagattgac
aaagctgttgcctttcagaacccacagactcgtatcattgagaacctacatgatgttgcc
tacaagaatgccttggctaatcccttgtactgtcctgactataggatggggaagataaca
tcagaggaattacattactttgttcagaatcacttcacaagtgcaagaatggctttggtt
ggacttggtgtgagtcattctatcctaaaggaagttgctgaacaatttctcaacattagg
ggtggccttggtttagctggtgcaaaagccaaataccgcggaggtgaaattagagagcag
aatggagacaatctggtccatgctgctattgtagcagaaagtgctgccattggaaatgca
gaagcaaatgcatttagtgtacttcagcatcttcttggtgctggaccacatatcaaaagg
ggcaacaacaccaccagcctcctgagccagagtgttgccaaaggaagtcaacagcctttt
gatgtttctgcatttaatgccagttactcagattctgggctctttggaatttacactgtc
tcccaggctgctgcggctggagatgttatcaatgctgcctacaaccaagtaaaagcagtt
gctcaaggaaacctttccagtgcagatgtccaggctgccaagaacaagctgaaagctgga
tatctaatgtctgtggagacttcagagggcttcctgagtgagatcgggtcacaggctcta
gctacaggctcttacatgccaccgcctactgtccttcagcaaattgacgctgtggctgat
gccgatgttgtaaaggctgcgaaaaagtttgtttctggcaagaagtcaatgacagcaagt
ggaaacttgggacatacgccttttcttgacgagttataa

KEGG   Rattus norvegicus (rat): 300047
Entry
300047            CDS       T01003                                 

Gene name
Cyc1
Definition
(RefSeq) cytochrome c-1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00151  Cytochrome bc1 complex respiratory unit
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    300047 (Cyc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    300047 (Cyc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    300047 (Cyc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    300047 (Cyc1)
   05012 Parkinson disease
    300047 (Cyc1)
   05014 Amyotrophic lateral sclerosis
    300047 (Cyc1)
   05016 Huntington disease
    300047 (Cyc1)
   05020 Prion disease
    300047 (Cyc1)
   05022 Pathways of neurodegeneration - multiple diseases
    300047 (Cyc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    300047 (Cyc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    300047 (Cyc1)
SSDB
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-GeneID: 300047
NCBI-ProteinID: NP_001264123
RGD: 1306597
Ensembl: ENSRNOG00000012457
UniProt: D3ZFQ8
Position
7
AA seq 326 aa
MAAAAAASLRRSVLGPRGMGLPGASAPGLLGGARPRHLPLRTPQAVSLSSKSGPSRGRKV
MLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ
VCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGNMFMRPGKLSDYFPKPY
PNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPG
QAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLL
LPLTYAMKRHKWSVLKSRKLAYRPPK
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcttcgcttcgccgatcggtgctaggcccgcggggcatgggg
cttccaggtgcaagtgctccgggcctgctgggcggcgcgcggccccggcatcttccatta
cggacaccgcaggcagtgtccttgtcctcgaagtctggcccttctcgaggccgaaaggtg
atgctgtcagcgttgggcatgctggcagcagggggtgcagggctagctgtggcccttcat
tcggcggtgagtgccagtgacctggagctgcacccccccagctacccatggtctcaccgt
ggcctcctctcctccttggaccacaccagcattcgtaggggtttccaggtatacaagcag
gtgtgctcttcctgccacagcatggattatgtggcttaccgccacctggtgggagtgtgc
tacacggaggaagaagctaaggcgctggctgaggaggtggaggtccaggatggccctaat
gaggatgggaatatgttcatgcggccagggaagctgtctgactattttccaaaaccatac
cccaaccctgaggctgcaagagctgctaacaatggagctttaccccctgacctcagctac
atcgttcgagcaaggcacggtggtgaggactatgtgttttccttgctcactggctactgt
gaacctcccactggggtgtcattgcgagaaggcctctatttcaacccttactttcctggc
caggccattggcatggctcctcccatctacacagaagtcttggagtatgacgatggtacc
ccagctaccatgtcacaagtagccaaggatgttgccaccttccttcgctgggcatcagag
ccagagcatgaccatcgaaaacgcatgggactcaagatgttgttgatgatgggcttgctg
ctgcccctgacctatgccatgaagcggcataagtggtcagtcctgaagagtcgaaagctg
gcttatcggccacccaagtga

KEGG   Rattus norvegicus (rat): 301011
Entry
301011            CDS       T01003                                 

Gene name
Uqcrc1
Definition
(RefSeq) cytochrome b-c1 complex subunit 1, mitochondrial precursor
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    301011 (Uqcrc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    301011 (Uqcrc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    301011 (Uqcrc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    301011 (Uqcrc1)
   05012 Parkinson disease
    301011 (Uqcrc1)
   05014 Amyotrophic lateral sclerosis
    301011 (Uqcrc1)
   05016 Huntington disease
    301011 (Uqcrc1)
   05020 Prion disease
    301011 (Uqcrc1)
   05022 Pathways of neurodegeneration - multiple diseases
    301011 (Uqcrc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    301011 (Uqcrc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301011 (Uqcrc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    301011 (Uqcrc1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M16: pitrilysin family
   301011 (Uqcrc1)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Other DBs
NCBI-GeneID: 301011
NCBI-ProteinID: NP_001004250
RGD: 1303314
Ensembl: ENSRNOG00000032134
UniProt: Q68FY0
Position
8
AA seq 480 aa
MAASAVCRAACSGTQALLRTCRSPALLRLPALRGTATFVQALQSVPETQVSVLDNGLRVA
SEQSSHPTCTVGVWIDVGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHL
NAYSTREHTAYLIKALSKDLPKVVELLADIVQNISLEDSQIEKERDVILREMQENDASMQ
NVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLSRHYKAPRMVLAAAGGVKHQ
QLLDLAQDHFSSVSQVYEEDAVPSITPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSETGLLGAHFVC
DAMSIDDMIFFLQGQWMRLCTSATESEVTRGKNILRNALISHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIEEVDAQMVREVCSKYFYDQCPAVAGYGPIEQLSDYNRIRSGMFWLRF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcgtccgcagtctgccgagcggcctgctctgggacgcaagcgctacttcgcacc
tgccgctcgccggccctgctgaggctacctgccttgcggggtaccgcaaccttcgtccag
gccctccagagcgtgccggagacacaggtcagcgtattggacaacgggctgcgtgtggcc
tcggagcagtcctcgcatcctacctgcacggtgggagtgtggattgacgttggcagtcgc
tatgagactgagaagaacaatggagcaggctactttttggaacatctggctttcaaggga
acaaagaaccgtcctggcaatgccttagagaaggaggtagagagtattggcgcccatctt
aatgcctacagcactcgggagcacactgcttacctcatcaaggcactgtccaaggacctg
ccaaaagttgtggagctcctggcagatattgtgcagaacattagtctggaagactcgcag
atcgagaaggagcgagatgtgatcctgcgggagatgcaggaaaacgatgcctctatgcag
aatgtagtcttcgattacctgcatgcaacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaacgtcaggaggctgtcgcgcacagacttgactgactacctc
agcaggcactacaaagctccccgaatggtgctggctgccgctggaggggtgaagcaccag
cagctgctagaccttgcccaggatcacttcagcagtgtctcccaggtgtatgaagaagac
gctgtacctagtataactccatgtcgcttcactggcagtgagatccgacatcgggatgat
gccctgcccttggcccatgtggccattgcagtagagggacctggctgggctaacccagac
aacgtggctctccaagtggccaatgccatcataggccactatgactgcacttacggtggt
ggagtgcacctgtccagcccgctggcttccgttgctgtagctaacaagctttgccagagt
ttccagaccttcaacatctcctactctgagaccgggttgctgggcgcacactttgtctgt
gatgccatgagcatcgatgacatgatcttcttcctgcaaggccagtggatgcgcctgtgc
accagcgctacagagagtgaggtgactcggggcaaaaacatccttaggaatgccttgata
tctcatttggatggcaccacccctgtgtgtgaagacattggtcgcagcctcctgacttat
ggccgccgcatccctctggctgagtgggagagccggattgaggaggtggatgcccagatg
gttcgagaggtttgctccaagtacttttatgaccaatgtccagcagtggctggatatggc
cccatcgaacagctctcagactacaaccggattcgcagtggcatgttctggctgcgcttc
tag

KEGG   Rattus norvegicus (rat): 362897
Entry
362897            CDS       T01003                                 

Gene name
Uqcrb
Definition
(RefSeq) cytochrome b-c1 complex subunit 7
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362897 (Uqcrb)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    362897 (Uqcrb)
  09159 Environmental adaptation
   04714 Thermogenesis
    362897 (Uqcrb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362897 (Uqcrb)
   05012 Parkinson disease
    362897 (Uqcrb)
   05014 Amyotrophic lateral sclerosis
    362897 (Uqcrb)
   05016 Huntington disease
    362897 (Uqcrb)
   05020 Prion disease
    362897 (Uqcrb)
   05022 Pathways of neurodegeneration - multiple diseases
    362897 (Uqcrb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    362897 (Uqcrb)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362897 (Uqcrb)
SSDB
Motif
Pfam: UCR_14kD
Other DBs
NCBI-GeneID: 362897
NCBI-ProteinID: NP_001121025
RGD: 1311971
Ensembl: ENSRNOG00000024967
UniProt: B2RYS2
Position
7
AA seq 111 aa
MAGRPAVAASSKWLDGFRKWYYNAAGFNKLGLMRDDTMHETEDVKEAIRRLPENLYNDRM
FRIKRALDLSMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcgggccgacctgcagttgcagcatcaagcaagtggctggatggtttccggaagtgg
tattataatgcagcgggcttcaataaactggggttaatgcgagatgacacaatgcatgaa
actgaagatgtaaaagaagccataagaaggctgcctgagaacctttataatgacagaatg
tttcgaattaagagagccctagacctgtctatgcggcatcagatcttgcctaaggatcag
tggacaaaatatgaggaggacaaattctaccttgaaccctatctgaaagaggttattcgg
gaaagaaaggagagagaagagtgggcgaagaagtga

KEGG   Rattus norvegicus (rat): 366448
Entry
366448            CDS       T01003                                 

Gene name
Uqcrh
Definition
(RefSeq) cytochrome b-c1 complex subunit 6, mitochondrial
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    366448 (Uqcrh)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    366448 (Uqcrh)
  09159 Environmental adaptation
   04714 Thermogenesis
    366448 (Uqcrh)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    366448 (Uqcrh)
   05012 Parkinson disease
    366448 (Uqcrh)
   05014 Amyotrophic lateral sclerosis
    366448 (Uqcrh)
   05016 Huntington disease
    366448 (Uqcrh)
   05020 Prion disease
    366448 (Uqcrh)
   05022 Pathways of neurodegeneration - multiple diseases
    366448 (Uqcrh)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    366448 (Uqcrh)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    366448 (Uqcrh)
SSDB
Motif
Pfam: UCR_hinge Herpes_UL14
Other DBs
NCBI-GeneID: 366448
NCBI-ProteinID: NP_001009480
RGD: 1305987
Ensembl: ENSRNOG00000012550
UniProt: Q5M9I5
Position
5
AA seq 89 aa
MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLESCDRRVSSRSQ
TEEDCTEELFDFLHARDHCVAHKLFKSLK
NT seq 270 nt   +upstreamnt  +downstreamnt
atgggactagaggatgaacgaaagatgctcactggctccggagaccccaaagaggaagaa
gaggaagaattagtggaccccctgacaacagtgagagagcactgtgagcagttggagaag
tgtgtaaaagcccgggaacgactagagtcgtgtgataggcgcgtgtcttcccgatcacag
acagaagaggattgtacagaggagctctttgacttcctgcatgcacgggatcactgtgtg
gcccacaaactcttcaaaagcttgaagtaa

KEGG   Rattus norvegicus (rat): 497902
Entry
497902            CDS       T01003                                 

Gene name
Uqcrq
Definition
(RefSeq) cytochrome b-c1 complex subunit 8
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    497902 (Uqcrq)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    497902 (Uqcrq)
  09159 Environmental adaptation
   04714 Thermogenesis
    497902 (Uqcrq)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    497902 (Uqcrq)
   05012 Parkinson disease
    497902 (Uqcrq)
   05014 Amyotrophic lateral sclerosis
    497902 (Uqcrq)
   05016 Huntington disease
    497902 (Uqcrq)
   05020 Prion disease
    497902 (Uqcrq)
   05022 Pathways of neurodegeneration - multiple diseases
    497902 (Uqcrq)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    497902 (Uqcrq)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    497902 (Uqcrq)
SSDB
Motif
Pfam: UcrQ Cyt_b-c1_8
Other DBs
NCBI-GeneID: 497902
NCBI-ProteinID: NP_001020305
RGD: 1562350
Ensembl: ENSRNOG00000048174
UniProt: Q7TQ16
Position
10
AA seq 82 aa
MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY
TWGNQEFAQSKRKNPAKYENDK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggccgcgagtttgggaacctgacgcggatacggcatgtgatctcctacagcttgtcg
ccctttgagcagcgcgccttcccgcactatttcagcaaaggcatccccaacgtgctgcgc
cgcactcgcgagcgcatcctgcgcgtggcgccgccatttgtactgttctatctgatctac
acatggggcaaccaggagtttgcgcagtccaaacggaagaatccagctaagtacgagaat
gacaagtga

KEGG   Rattus norvegicus (rat): 685322
Entry
685322            CDS       T01003                                 

Gene name
Uqcr10
Definition
(RefSeq) ubiquinol-cytochrome c reductase complex 7.2kDa protein
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    685322 (Uqcr10)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    685322 (Uqcr10)
  09159 Environmental adaptation
   04714 Thermogenesis
    685322 (Uqcr10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    685322 (Uqcr10)
   05012 Parkinson disease
    685322 (Uqcr10)
   05014 Amyotrophic lateral sclerosis
    685322 (Uqcr10)
   05016 Huntington disease
    685322 (Uqcr10)
   05020 Prion disease
    685322 (Uqcr10)
   05022 Pathways of neurodegeneration - multiple diseases
    685322 (Uqcr10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    685322 (Uqcr10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    685322 (Uqcr10)
SSDB
Motif
Pfam: UCR_UQCRX_QCR9
Other DBs
NCBI-GeneID: 685322
NCBI-ProteinID: NP_001163936
RGD: 1595126
UniProt: B2RYX1
Position
14
AA seq 64 aa
MASPTVTSRLYSLLFRRTSTFALTIAVSALFFERAFDQGADAVYDYINEGKLWKHIKHKY
EKQE
NT seq 195 nt   +upstreamnt  +downstreamnt
atggcgtcgccgacggtcacttcgcgtttgtactccttgctgttccgcaggacttctacc
ttcgccctcaccatcgcagtgagcgccctgttcttcgagcgcgccttcgatcagggtgca
gacgcggtctacgattacatcaacgaggggaaactgtggaaacacataaagcacaagtac
gagaaacaggagtaa

KEGG   Rattus norvegicus (rat): 690848
Entry
690848            CDS       T01003                                 

Gene name
Uqcr11
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    690848 (Uqcr11)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    690848 (Uqcr11)
  09159 Environmental adaptation
   04714 Thermogenesis
    690848 (Uqcr11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    690848 (Uqcr11)
   05012 Parkinson disease
    690848 (Uqcr11)
   05014 Amyotrophic lateral sclerosis
    690848 (Uqcr11)
   05016 Huntington disease
    690848 (Uqcr11)
   05020 Prion disease
    690848 (Uqcr11)
   05022 Pathways of neurodegeneration - multiple diseases
    690848 (Uqcr11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    690848 (Uqcr11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    690848 (Uqcr11)
SSDB
Motif
Pfam: UCR_6-4kD QCR10
Other DBs
NCBI-GeneID: 690848
NCBI-ProteinID: NP_001119569
RGD: 1590985
Ensembl: ENSRNOG00000016952
UniProt: A9UMV7
Position
7
AA seq 56 aa
MLSRFLGPRYRELAKNWIPTAGMWGTVGAVGLVWVTDWRLILDWVPYINGKFKKDD
NT seq 171 nt   +upstreamnt  +downstreamnt
atgctcagcagatttctaggcccgcgctaccgagaactggccaaaaactggatccccaca
gccggcatgtggggcactgtgggtgccgtgggactggtgtgggtcacggactggcggctg
atcctggactgggtgccgtacatcaatggcaagtttaagaaggacgattag

DBGET integrated database retrieval system