KEGG   Rattus norvegicus (rat): 100361294Help
Entry
100361294         CDS       T01003                                 

Gene name
Tyk2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100361294 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100361294 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100361294 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    100361294 (Tyk2)
   04659 Th17 cell differentiation
    100361294 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100361294 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100361294 (Tyk2)
   05164 Influenza A
    100361294 (Tyk2)
   05161 Hepatitis B
    100361294 (Tyk2)
   05160 Hepatitis C
    100361294 (Tyk2)
   05168 Herpes simplex virus 1 infection
    100361294 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100361294 (Tyk2)
   05169 Epstein-Barr virus infection
    100361294 (Tyk2)
   05165 Human papillomavirus infection
    100361294 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100361294 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100361294 (Tyk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100361294 (Tyk2)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100361294 (Tyk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100361294
NCBI-ProteinID: NP_001244276
RGD: 2320469
Ensembl: ENSRNOG00000032948
UniProt: D3ZD03
Position
8q13
AA seq 1186 aa AA seqDB search
MVTSMPLCGRRAASEDSKADGTEAQPLVPTGRLMVLLHWPGPEGGEPWVTFSQPSLTAEE
MCIHIAHKVGITPPCLNLFALYDAQAKVWLPPNHVLDTSQDATLRLYFRMRFYFRNWHGM
NPQEPAVYRCGFPGAETSSDHAEQGVQLLDSASFEYLFEQGKHEFMNDVVSLRDLSSEEE
IHHFKNESLGMAFLHLCHLALNRGVPLEEMAREISFKNCIPHSFRQHIRQHNVLTRLRLR
RVFRRFLQAFQPGHLSQQVVMVKYLATLERLAPRFGSEHIPVCHLEVLAQPERDPCYIQN
SGQTTGDPGPELASGPATHEVLVTGTGGIQWRPLQTQDSERGHSRGNPQGSQSGKKPKAP
ESGEHLAGSPQEPPWTYFCDFQDISHVVLKERRVHIHLQDNKCLLLCLCSQAEALSFVAL
VDGYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDPFVQAKLWPEDGLYLIQWSTSH
LHRLILTVAHRNPASRNGPRGLRLRKFPITQQPGAFVLDGWGRSFDSLGDLRQALQGCSL
RAGDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLSQLSFHRVHQDEITQLSHLGQG
TRTNVYEGLLSVGGPNEGKVDSGCPSGPDRGSGQQLRVVLKVLDPSHHDIALAFYETASL
MSQVSHMHLAFLHGVCVRGSENIIVAEFVEHGPLDVWLRRQRGRVPMPWKMVVAQQLASA
LSYLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDPGVGQGALSREERVERIPWTAP
ECLSGGANSLGTATDMWGFGATLLEICFDGEAPLQGRGPSEKERFYTKKHQLPEPSCPEL
ATLTRQCLSYEPAQRPSFRTILRDLTRLQPQNLVGTSTVNSDSPASDPTVFHKRYLKRIR
DLGEGHFGKVSLYCYDPNNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVK
YKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIH
RDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYA
SDVWSFGVTLYELLTYCDSSQSPPTKFIELIGVTQGQMTVLRLTELLERGERLPRPDRCP
CEIYHLMKNCWESEASFRPTFQNLVPILKTAQEKYQGQVPSVFSVC
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaagcatgcctctgtgtgggcggagagccgcctcggaagacagcaaggcagat
ggcacagaagctcagcccctggtgcccacaggacggttgatggtgctgctgcactggccc
gggcctgagggcggggagccctgggtcaccttcagccagccatctctgactgcagaggag
atgtgcatccacatcgcacacaaagtcggcatcactccaccctgcctgaatctcttcgca
ctctacgatgcacaggccaaggtctggctgcccccaaaccacgttctggacacatcccaa
gacgcaaccctgaggctctattttcgaatgaggttttacttccggaactggcatggcatg
aatccccaagagcctgctgtataccgatgtggtttcccaggggcagagacttcctcagac
catgcagagcaaggtgtacagctcttggactctgcctcatttgaatacctttttgagcag
ggaaaacatgaattcatgaacgatgtggtatctctgcgggacctgtctagcgaggaagag
atccaccactttaagaatgagagcctgggcatggcctttctgcacctctgccatcttgct
ctcaaccgtggcgtccccctggaggagatggccagagagatcagcttcaagaactgtatc
cctcactccttccgtcagcacatccgccagcacaatgtgcttacgcgcctgcgtctccgc
agagtcttccgccgcttcctgcaggccttccagcctggccacctctcccaacaggttgtg
atggttaagtacttggccaccctggagcggctggctcctcgttttggctcagagcacata
cctgtgtgtcatctggaagttctggcccagcctgagagggacccctgctacatccagaac
agtgggcagaccactggggacccaggcccagagctggcttctgggccagccacccatgag
gtactggtgacaggcaccggaggtatccagtggcgtccactacagacccaggactctgag
agaggtcacagcagagggaatccccaaggcagccagtctgggaagaaacccaaggcccct
gagtctggagagcacctggcagggagtccccaggaaccaccttggacctacttctgtgac
ttccaggacatttcccatgtggtactaaaggagcgtcgagtgcacatccaccttcaagac
aacaagtgcttgttgctgtgcctctgctcccaggccgaggccctgtcctttgtggccctg
gtcgatggctatttccgcttgactgctgactccagccactacctgtgccatgaggtagca
cccccgaggctggtgactagcatccagaatggcatccacgggcccctgatggacccattt
gtacaggctaagctgtggccagaggatggcctctacctgatccagtggagcaccagccac
ctgcaccgactgatcctcaccgtagcccatcgaaacccggcttccagaaacggccctagg
ggcctacgcctccgaaagttccccatcacccagcagcctggagcctttgtgcttgatggt
tggggccgctcctttgacagcttgggggaccttcggcaggccttgcagggctgctcattg
cgagctggtgatgactgtttcccgttgcaccactgctgcctgccccgaccaagagaaatc
tccaaccttgtcatcatgcgggggtctagggcccacacccggccactcaacctcagtcag
cttagcttccacagggttcaccaggatgaaatcacccagctgtcccacttgggccaaggc
acaaggaccaatgtgtatgagggcctgctaagtgtgggaggccccaatgagggcaaagtg
gacagtggatgcccctctgggcctgataggggcagtgggcagcagcttcgagtggtgctc
aaagtcctcgaccctagtcaccatgatatcgccttggccttctatgagactgccagcctc
atgagccaggtgtcacacatgcacctggctttcctgcatggtgtctgcgtgcgtggctca
gagaatatcattgtagcggaattcgtagagcacggtcccctggatgtgtggttacggaga
cagagaggccgagtgcccatgccctggaagatggtcgtggctcagcagctggccagcgcc
ctgagctacctggaggacaagaatctggttcacgggaacgtatgtggccggaacatcctg
ctggcccgcctggggctggaggagggtaccaaccccttcatcaagctcagtgaccctggc
gtgggccaaggcgccctctccagggaagagcgggtggagcgaatcccctggacagctccg
gagtgcctgtccggaggggccaacagcttgggcactgccacggacatgtggggctttggt
gccaccctccttgagatctgttttgatggagaggcacctctgcagggccgtggtccctcc
gagaaagaacggttctacacaaagaaacatcagctgccagagccctcatgcccggagctg
gccacactcacccgtcagtgcctgagctatgaacccgcacagaggccatcgttccgcacc
attttgcgggacctcacaagactgcagccacagaatctagtgggaacttcgactgtgaac
tcggactcaccagcatcggaccccaccgtttttcacaagcgttacttgaaaaggatccgg
gatttgggtgagggtcactttggcaaggtcagcctgtactgctatgacccgaacaatgac
ggcactggcgagatggtggctgtgaaagccctgaaggagggatgtggtccccagctccgc
tcaggctggcagcgggagatcgaaatccttcggacgctgtaccacgagcacattgtcaag
tacaaaggctgctgtgaagaccaaggggagaagtctgtacagctggtcatggaatacgtc
cctctgggcagcctccgagactacctgccaaggcacagcgtggggctggctcagctcctg
ttgtttgcccagcagatctgcgagggcatggcttacctgcacgctcagcactacattcac
cgagacctcgctgcgcgaaacgtgctgctggacaacgaccggctggtcaagattggagac
tttggcctagccaaggctgtacctgaaggccacgagtactaccgagtgcgcgaggacggg
gacagcccagtattctggtatgccccagaatgcctaaaggagtgcaagttttactatgca
tctgatgtctggtccttcggggtgaccctttatgagctgttgacatactgtgactctagc
cagagtccccccacgaaattcatcgagctcatcggcgtaacccagggccagatgactgtg
ctgaggctcacagagctgctggagcgaggggagaggctgccgcggcctgacagatgtccc
tgtgagatctatcacctcatgaagaactgctgggagtcagaggcctccttccggcccacg
ttccagaatcttgtgcccatccttaagacagcacaggagaagtaccaaggccaggtgcct
tcagtgttcagcgtgtgctga

DBGET integrated database retrieval system