KEGG   Rattus norvegicus (rat): 100361294
Entry
100361294         CDS       T01003                                 

Gene name
Tyk2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100361294 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100361294 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100361294 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    100361294 (Tyk2)
   04659 Th17 cell differentiation
    100361294 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100361294 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100361294 (Tyk2)
   05160 Hepatitis C
    100361294 (Tyk2)
   05171 Coronavirus disease - COVID-19
    100361294 (Tyk2)
   05164 Influenza A
    100361294 (Tyk2)
   05162 Measles
    100361294 (Tyk2)
   05168 Herpes simplex virus 1 infection
    100361294 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100361294 (Tyk2)
   05169 Epstein-Barr virus infection
    100361294 (Tyk2)
   05165 Human papillomavirus infection
    100361294 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100361294 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100361294 (Tyk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100361294 (Tyk2)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100361294 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo APH ABC1
Other DBs
NCBI-GeneID: 100361294
NCBI-ProteinID: NP_001244276
RGD: 2320469
Ensembl: ENSRNOG00000032948
UniProt: D3ZD03
Position
8
AA seq 1186 aa
MVTSMPLCGRRAASEDSKADGTEAQPLVPTGRLMVLLHWPGPEGGEPWVTFSQPSLTAEE
MCIHIAHKVGITPPCLNLFALYDAQAKVWLPPNHVLDTSQDATLRLYFRMRFYFRNWHGM
NPQEPAVYRCGFPGAETSSDHAEQGVQLLDSASFEYLFEQGKHEFMNDVVSLRDLSSEEE
IHHFKNESLGMAFLHLCHLALNRGVPLEEMAREISFKNCIPHSFRQHIRQHNVLTRLRLR
RVFRRFLQAFQPGHLSQQVVMVKYLATLERLAPRFGSEHIPVCHLEVLAQPERDPCYIQN
SGQTTGDPGPELASGPATHEVLVTGTGGIQWRPLQTQDSERGHSRGNPQGSQSGKKPKAP
ESGEHLAGSPQEPPWTYFCDFQDISHVVLKERRVHIHLQDNKCLLLCLCSQAEALSFVAL
VDGYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDPFVQAKLWPEDGLYLIQWSTSH
LHRLILTVAHRNPASRNGPRGLRLRKFPITQQPGAFVLDGWGRSFDSLGDLRQALQGCSL
RAGDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLSQLSFHRVHQDEITQLSHLGQG
TRTNVYEGLLSVGGPNEGKVDSGCPSGPDRGSGQQLRVVLKVLDPSHHDIALAFYETASL
MSQVSHMHLAFLHGVCVRGSENIIVAEFVEHGPLDVWLRRQRGRVPMPWKMVVAQQLASA
LSYLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDPGVGQGALSREERVERIPWTAP
ECLSGGANSLGTATDMWGFGATLLEICFDGEAPLQGRGPSEKERFYTKKHQLPEPSCPEL
ATLTRQCLSYEPAQRPSFRTILRDLTRLQPQNLVGTSTVNSDSPASDPTVFHKRYLKRIR
DLGEGHFGKVSLYCYDPNNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVK
YKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIH
RDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYA
SDVWSFGVTLYELLTYCDSSQSPPTKFIELIGVTQGQMTVLRLTELLERGERLPRPDRCP
CEIYHLMKNCWESEASFRPTFQNLVPILKTAQEKYQGQVPSVFSVC
NT seq 3561 nt   +upstreamnt  +downstreamnt
atggtgacaagcatgcctctgtgtgggcggagagccgcctcggaagacagcaaggcagat
ggcacagaagctcagcccctggtgcccacaggacggttgatggtgctgctgcactggccc
gggcctgagggcggggagccctgggtcaccttcagccagccatctctgactgcagaggag
atgtgcatccacatcgcacacaaagtcggcatcactccaccctgcctgaatctcttcgca
ctctacgatgcacaggccaaggtctggctgcccccaaaccacgttctggacacatcccaa
gacgcaaccctgaggctctattttcgaatgaggttttacttccggaactggcatggcatg
aatccccaagagcctgctgtataccgatgtggtttcccaggggcagagacttcctcagac
catgcagagcaaggtgtacagctcttggactctgcctcatttgaatacctttttgagcag
ggaaaacatgaattcatgaacgatgtggtatctctgcgggacctgtctagcgaggaagag
atccaccactttaagaatgagagcctgggcatggcctttctgcacctctgccatcttgct
ctcaaccgtggcgtccccctggaggagatggccagagagatcagcttcaagaactgtatc
cctcactccttccgtcagcacatccgccagcacaatgtgcttacgcgcctgcgtctccgc
agagtcttccgccgcttcctgcaggccttccagcctggccacctctcccaacaggttgtg
atggttaagtacttggccaccctggagcggctggctcctcgttttggctcagagcacata
cctgtgtgtcatctggaagttctggcccagcctgagagggacccctgctacatccagaac
agtgggcagaccactggggacccaggcccagagctggcttctgggccagccacccatgag
gtactggtgacaggcaccggaggtatccagtggcgtccactacagacccaggactctgag
agaggtcacagcagagggaatccccaaggcagccagtctgggaagaaacccaaggcccct
gagtctggagagcacctggcagggagtccccaggaaccaccttggacctacttctgtgac
ttccaggacatttcccatgtggtactaaaggagcgtcgagtgcacatccaccttcaagac
aacaagtgcttgttgctgtgcctctgctcccaggccgaggccctgtcctttgtggccctg
gtcgatggctatttccgcttgactgctgactccagccactacctgtgccatgaggtagca
cccccgaggctggtgactagcatccagaatggcatccacgggcccctgatggacccattt
gtacaggctaagctgtggccagaggatggcctctacctgatccagtggagcaccagccac
ctgcaccgactgatcctcaccgtagcccatcgaaacccggcttccagaaacggccctagg
ggcctacgcctccgaaagttccccatcacccagcagcctggagcctttgtgcttgatggt
tggggccgctcctttgacagcttgggggaccttcggcaggccttgcagggctgctcattg
cgagctggtgatgactgtttcccgttgcaccactgctgcctgccccgaccaagagaaatc
tccaaccttgtcatcatgcgggggtctagggcccacacccggccactcaacctcagtcag
cttagcttccacagggttcaccaggatgaaatcacccagctgtcccacttgggccaaggc
acaaggaccaatgtgtatgagggcctgctaagtgtgggaggccccaatgagggcaaagtg
gacagtggatgcccctctgggcctgataggggcagtgggcagcagcttcgagtggtgctc
aaagtcctcgaccctagtcaccatgatatcgccttggccttctatgagactgccagcctc
atgagccaggtgtcacacatgcacctggctttcctgcatggtgtctgcgtgcgtggctca
gagaatatcattgtagcggaattcgtagagcacggtcccctggatgtgtggttacggaga
cagagaggccgagtgcccatgccctggaagatggtcgtggctcagcagctggccagcgcc
ctgagctacctggaggacaagaatctggttcacgggaacgtatgtggccggaacatcctg
ctggcccgcctggggctggaggagggtaccaaccccttcatcaagctcagtgaccctggc
gtgggccaaggcgccctctccagggaagagcgggtggagcgaatcccctggacagctccg
gagtgcctgtccggaggggccaacagcttgggcactgccacggacatgtggggctttggt
gccaccctccttgagatctgttttgatggagaggcacctctgcagggccgtggtccctcc
gagaaagaacggttctacacaaagaaacatcagctgccagagccctcatgcccggagctg
gccacactcacccgtcagtgcctgagctatgaacccgcacagaggccatcgttccgcacc
attttgcgggacctcacaagactgcagccacagaatctagtgggaacttcgactgtgaac
tcggactcaccagcatcggaccccaccgtttttcacaagcgttacttgaaaaggatccgg
gatttgggtgagggtcactttggcaaggtcagcctgtactgctatgacccgaacaatgac
ggcactggcgagatggtggctgtgaaagccctgaaggagggatgtggtccccagctccgc
tcaggctggcagcgggagatcgaaatccttcggacgctgtaccacgagcacattgtcaag
tacaaaggctgctgtgaagaccaaggggagaagtctgtacagctggtcatggaatacgtc
cctctgggcagcctccgagactacctgccaaggcacagcgtggggctggctcagctcctg
ttgtttgcccagcagatctgcgagggcatggcttacctgcacgctcagcactacattcac
cgagacctcgctgcgcgaaacgtgctgctggacaacgaccggctggtcaagattggagac
tttggcctagccaaggctgtacctgaaggccacgagtactaccgagtgcgcgaggacggg
gacagcccagtattctggtatgccccagaatgcctaaaggagtgcaagttttactatgca
tctgatgtctggtccttcggggtgaccctttatgagctgttgacatactgtgactctagc
cagagtccccccacgaaattcatcgagctcatcggcgtaacccagggccagatgactgtg
ctgaggctcacagagctgctggagcgaggggagaggctgccgcggcctgacagatgtccc
tgtgagatctatcacctcatgaagaactgctgggagtcagaggcctccttccggcccacg
ttccagaatcttgtgcccatccttaagacagcacaggagaagtaccaaggccaggtgcct
tcagtgttcagcgtgtgctga

KEGG   Rattus norvegicus (rat): 84598
Entry
84598             CDS       T01003                                 

Gene name
Jak1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04621  NOD-like receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    84598 (Jak1)
   04151 PI3K-Akt signaling pathway
    84598 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    84598 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84598 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    84598 (Jak1)
   04658 Th1 and Th2 cell differentiation
    84598 (Jak1)
   04659 Th17 cell differentiation
    84598 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    84598 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84598 (Jak1)
   05203 Viral carcinogenesis
    84598 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    84598 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    84598 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    84598 (Jak1)
   05161 Hepatitis B
    84598 (Jak1)
   05160 Hepatitis C
    84598 (Jak1)
   05171 Coronavirus disease - COVID-19
    84598 (Jak1)
   05164 Influenza A
    84598 (Jak1)
   05162 Measles
    84598 (Jak1)
   05168 Herpes simplex virus 1 infection
    84598 (Jak1)
   05163 Human cytomegalovirus infection
    84598 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    84598 (Jak1)
   05169 Epstein-Barr virus infection
    84598 (Jak1)
   05165 Human papillomavirus infection
    84598 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    84598 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    84598 (Jak1)
   05140 Leishmaniasis
    84598 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    84598 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84598 (Jak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     84598 (Jak1)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   84598 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 RIO1 SH2
Other DBs
NCBI-GeneID: 84598
NCBI-ProteinID: NP_445918
RGD: 69056
Ensembl: ENSRNOG00000011157
UniProt: G3V9W2
Position
5
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVAPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNHIITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELS
RCHSNDSGNVLYEVMVTGNLGIQWRQKPNVLPVEKEKNKLKRKKLDYNKHKKEDDRNKLR
EEWNSFSYFPEITHIVIKESVVSINKQDNKNMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVS
CFEKSEVLGNQKQFKNFQIEVQKGRYSLHGSVDHFPSLRDLMNHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGT
LLDYKDDEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSDIGPFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKQPITEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
FSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLSCPPNCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agcttcaagaagacggaggtgaagcaggtggcccctgagccaggagtggaagtgactttc
tatctgttggacagggagcccctccgcctgggcagcggagagtacaccgcggaggagctg
tgcatcagggccgcacaggaatgcagtatctctcctctctgccacaacctcttcgccttg
tatgatgagagcaccaagctctggtatgctccaaaccacatcatcactgtggatgacaaa
atgtctctccggctgcactaccgcatgaggttctactttaccaactggcatggaaccaat
gacaatgaacagtctgtatggcgacattctccaaagaagcagaaaaatggctatgagaag
aaaaaggttccagaagcaaccccactccttgatgccagttcactggagtatctgtttgcg
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacagagcaa
gatggacatgatattgagaatgagtgcctgggcatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagagcttcccaaagacatcagctacaagcgatat
attccagaaacattgaataaatccatcagacagaggaatcttcttaccaggatgcgaata
aataatgttttcaaggatttcttgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtctacacacgacctgaaggtgaagtacctggctaccttggaaaccttaaccaagcat
tatggagccgagatatttgagacttctatgctcctgatttcatcagaaaatgagctgagt
cggtgccattccaacgacagtggcaatgttctctatgaagtcatggtaacaggaaatctc
gggatccagtggcggcagaaaccaaatgttcttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggactataataaacacaagaaggaggatgacagaaacaaactccgg
gaagagtggaacagtttttcctatttccccgagattacccacattgttatcaaggagtct
gtggtcagcattaacaaacaggacaacaagaacatggaactaaagctctcttctcatgag
gaagccttgtccttcgtgtccctggtagatggctacttccggctcactgcagatgctcac
cattacctctgtactgatgtggctcccccgctgattgtccacaacatacagaatggctgt
cacggtccaatctgcacagaatatgccatcaataagctgcggcaggaggggagtgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacattcttatgactgtcagc
tgcttcgaaaagtccgaggtattgggtaatcagaagcagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctctgttgaccactttcccagcctgagagac
ctcatgaaccacctcaagaagcagatcctgcgcacggacaatataagctttgtgctgaaa
cgctgctgtcagcctaagcctcgagaaatctccaacctacttgtagccactaagaaagcc
caggagtggcagcctgtctactctatgagccagctgagtttcgatcggatccttaagaaa
gatattatccaaggtgagcaccttggcagaggcacaagaacacatatctattctgggacc
ctgctggattacaaggacgatgaaggaattgctgaagaaaagaagataaaagtgattctc
aaagtcctagaccctagccaccgggacatttcactggccttctttgaggcagccagcatg
atgagacaggtttcccacaaacacatcgtgtacctctacggcgtctgtgtccgagatgtg
gaaaatatcatggtggaagagtttgtggagggggggccattggatctcttcatgcaccgg
aaaagtgatgcacttactaccccttggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaagataaagacctcgttcatggaaatgtgtgcactaaaaacctcctc
ctggcccgtgagggcattgacagtgacattggcccgttcatcaagcttagtgaccctggc
atcccagtctctgtgctgaccaggcaagagtgcatagagcgaattccctggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatcccactcaaggacaagaccctcattgag
aaagagaggttttatgaaagccgctgcaggccagtgacaccatcttgcaaggagctagct
gacctcatgactcgctgcatgaactatgatcccaaccagagacctttcttccgagccatc
atgagggacattaacaagctggaggagcagaatccagacattgtttcagaaaagcagcca
ataacagaggtggatcccactcattttgaaaagcgtttcctaaagaggattcgtgacttg
ggagagggtcactttgggaaggttgagctctgcagatatgatcctgagggagacaacaca
ggggaacaggtagctgtcaagtccctgaagcctgagagtggaggtaaccacatagctgat
ctgaagaaggagatagagatcttacggaacctctaccacgagaacattgtgaagtataaa
ggaatctgcatggaagacggagggaatggtatcaagctcatcatggagtttctgccttcg
ggaagcctaaaggaatatctgccaaagaataagaacaaaatcaacctcaaacagcagcta
aaatatgccatccagatttgtaaggggatggactatctgggctctcggcaatatgttcac
cgggacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaagatcggagac
tttggtttaaccaaagcaattgagaccgataaggagtactacacagtcaaggatgaccgg
gacagcccagtgttttggtacgctccggagtgtttaatccagtgtaaattttatatcgcc
tctgatgtctggtcttttggagtgacactgcacgagttgctcacgtactgtgactcagat
tttagtcccatggccttgttcctgaaaatgataggcccaactcatggccagatgacagta
acacggcttgtgaatactctgaaagaaggaaagcgcctgtcctgtccacccaactgtccc
gatgaggtttatcagcttatgagaaaatgctgggaattccaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system