KEGG   Rattus norvegicus (rat): 100361431Help
Entry
100361431         CDS       T01003                                 

Gene name
Syce1l
Definition
(RefSeq) synaptonemal complex central element protein 1-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SYCE1 TEX12
Motif
Other DBs
NCBI-GeneID: 100361431
NCBI-ProteinID: XP_006222826
RGD: 2320134
Ensembl: ENSRNOG00000031097
UniProt: D4AAR3
Position
19q12
AA seq 245 aa AA seqDB search
MAAELEPLKAEWLGAEKAEDTGGQTTSLNTTEDLLETVKKLQKEGSLEPQIEDLIHRINE
LQQAKKRSSEELGEAQALQEAMHQELDSLNEEKVHLEEVLCKKQDALLILQKHPQERESE
TTCLDAKQMEEKLEDLASQHKDLWEFHVLQQRLAQEISTMEHRKDQLLMERTLLQVRLKE
VEQKLQEAREAQDSPENCGLKTELEEFGEQSQNIPEAQNDRGEAGQEEQHHVEPSDELPR
TGTPC
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaactggagcctttgaaggcggagtggctgggagctgagaaagctgaagac
accggagggcagaccacctctctgaatacgacggaagacttgctggagacagtgaaaaag
ctacagaaagagggaagcctggaaccccagatcgaggacctgatccatcgaattaatgag
ctgcagcaagcaaagaagagatccagtgaggagctgggagaggctcaagcactccaggaa
gccatgcatcaggaactagattccttgaatgaagagaaagtccacctagaggaggtcctg
tgcaaaaagcaagatgctctgttaattctccagaaacatccccaagagagagaaagtgag
actacatgcttggatgctaaacaaatggaagagaagctggaggatctggcaagtcaacac
aaggacctctgggagttccatgtcctacagcagcgactggcccaggagatcagcacgatg
gagcacaggaaagatcagctgctgatggagaggactttgctgcaagtcaggctgaaggag
gtggagcagaagctacaggaggccagggaggcccaggatagcccagagaattgtggtctg
aagacagagctggaggaatttggggagcagtcccagaacatcccagaagctcagaatgac
agaggggaggctggccaagaggagcagcatcatgtggagccatccgatgagttgccaagg
acaggaacgccctgctaa

DBGET integrated database retrieval system