KEGG   Rattus norvegicus (rat): 100361457
Entry
100361457         CDS       T01003                                 

Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
rno05014  Amyotrophic lateral sclerosis
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05164  Influenza A
rno05205  Proteoglycans in cancer
rno05225  Hepatocellular carcinoma
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05416  Viral myocarditis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100361457
   04390 Hippo signaling pathway
    100361457
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100361457
  09143 Cell growth and death
   04210 Apoptosis
    100361457
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100361457
   04520 Adherens junction
    100361457
   04530 Tight junction
    100361457
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100361457
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100361457
   04613 Neutrophil extracellular trap formation
    100361457
   04670 Leukocyte transendothelial migration
    100361457
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100361457
   04919 Thyroid hormone signaling pathway
    100361457
  09154 Digestive system
   04971 Gastric acid secretion
    100361457
  09159 Environmental adaptation
   04714 Thermogenesis
    100361457
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100361457
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100361457
  09172 Infectious disease: viral
   05164 Influenza A
    100361457
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100361457
   05135 Yersinia infection
    100361457
   05100 Bacterial invasion of epithelial cells
    100361457
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100361457
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100361457
   05410 Hypertrophic cardiomyopathy
    100361457
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100361457
   05414 Dilated cardiomyopathy
    100361457
   05416 Viral myocarditis
    100361457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100361457
   03019 Messenger RNA biogenesis [BR:rno03019]
    100361457
   03036 Chromosome and associated proteins [BR:rno03036]
    100361457
   03029 Mitochondrial biogenesis [BR:rno03029]
    100361457
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    100361457
   04147 Exosome [BR:rno04147]
    100361457
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100361457
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100361457
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100361457
    NuA4 complex
     100361457
  Chromatin remodeling factors
   BAF complex
    100361457
   PBAF complex
    100361457
   SWR1 complex
    100361457
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100361457
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100361457
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   100361457
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100361457
NCBI-ProteinID: XP_002729242
RGD: 2320108
Ensembl: ENSRNOG00000053452
UniProt: P63259
Position
3
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaatcgccgccctcgtcattgacaatggctccggcatgtgcaaagctggc
tttgctggggacgacgcccccagggccgtgtttccttccatcgtcgggcgcccccgacac
cagggtgtcatggtgggcatgggccagaaagactcgtacgtgggtgatgaggcccagagc
aagaggggtattctgaccctgaagtaccctattgagcacggcattgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgaggag
cacccggtgcttctgaccgaggcccccctgaaccccaaagctaacagagagaagatgacg
cagataatgtttgaaaccttcaataccccagccatgtacgtggccattcaggcggtgctc
tccttgtatgcatctgggcgtaccactggcattgtcatggactctggtgacggggtcaca
cacacagtgcccatctatgagggctacgcccttccccacgccatcttgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgactgaaaggggctacagcttt
accaccactgctgagagggaaattgttcgtgacataaaggagaagctgtgctatgttgcc
ctggattttgagcaagaaatggctactgctgcatcatcttcctctttggagaagagttat
gagctgcctgatgggcaggtgatcaccattggcaatgagcgcttccggtgtccagaggct
ctcttccagccttccttcctgggcatggagtcctgtggcatccacgagaccaccttcaac
tccatcatgaagtgtgatgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtaccaccatgtatccaggcattgctgacaggatgcagaaggagatcacagccctg
gctcccagcacaatgaagattaagatcattgctcctcctgaacgcaagtactcagtctgg
attggcggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtcaggcccctccattgtccaccgcaaatgcttctag

KEGG   Rattus norvegicus (rat): 287876
Entry
287876            CDS       T01003                                 

Gene name
Actg1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
rno05014  Amyotrophic lateral sclerosis
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05164  Influenza A
rno05205  Proteoglycans in cancer
rno05225  Hepatocellular carcinoma
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05416  Viral myocarditis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    287876 (Actg1)
   04390 Hippo signaling pathway
    287876 (Actg1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    287876 (Actg1)
  09143 Cell growth and death
   04210 Apoptosis
    287876 (Actg1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    287876 (Actg1)
   04520 Adherens junction
    287876 (Actg1)
   04530 Tight junction
    287876 (Actg1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    287876 (Actg1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    287876 (Actg1)
   04613 Neutrophil extracellular trap formation
    287876 (Actg1)
   04670 Leukocyte transendothelial migration
    287876 (Actg1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    287876 (Actg1)
   04919 Thyroid hormone signaling pathway
    287876 (Actg1)
  09154 Digestive system
   04971 Gastric acid secretion
    287876 (Actg1)
  09159 Environmental adaptation
   04714 Thermogenesis
    287876 (Actg1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    287876 (Actg1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    287876 (Actg1)
  09172 Infectious disease: viral
   05164 Influenza A
    287876 (Actg1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287876 (Actg1)
   05135 Yersinia infection
    287876 (Actg1)
   05100 Bacterial invasion of epithelial cells
    287876 (Actg1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    287876 (Actg1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    287876 (Actg1)
   05410 Hypertrophic cardiomyopathy
    287876 (Actg1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    287876 (Actg1)
   05414 Dilated cardiomyopathy
    287876 (Actg1)
   05416 Viral myocarditis
    287876 (Actg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    287876 (Actg1)
   03019 Messenger RNA biogenesis [BR:rno03019]
    287876 (Actg1)
   03036 Chromosome and associated proteins [BR:rno03036]
    287876 (Actg1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    287876 (Actg1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287876 (Actg1)
   04147 Exosome [BR:rno04147]
    287876 (Actg1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     287876 (Actg1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     287876 (Actg1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     287876 (Actg1)
    NuA4 complex
     287876 (Actg1)
  Chromatin remodeling factors
   BAF complex
    287876 (Actg1)
   PBAF complex
    287876 (Actg1)
   SWR1 complex
    287876 (Actg1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    287876 (Actg1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     287876 (Actg1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   287876 (Actg1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 287876
NCBI-ProteinID: NP_001120921
RGD: 1304556
Ensembl: ENSRNOG00000036701
UniProt: P63259
Position
10
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaatcgccgccctcgtcattgacaatggctccggcatgtgcaaagctggc
tttgctggggacgacgcccccagggccgtgtttccttccatcgtcgggcgcccccgacac
cagggtgtcatggtgggcatgggccagaaagactcgtacgtgggtgatgaggcccagagc
aagaggggtattctgaccctgaagtaccctattgagcacggcattgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgaggag
cacccggtgcttctgaccgaggcccccctgaaccccaaagctaacagagagaagatgacg
cagataatgtttgaaaccttcaataccccagccatgtacgtggccattcaggcggtgctc
tccttgtatgcatctgggcgtaccactggcattgtcatggactctggtgacggggtcaca
cacacagtgcccatctatgagggctacgcccttccccacgccatcttgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgactgaaaggggctacagcttt
accaccactgctgagagggaaattgttcgtgacataaaggagaagctgtgctatgttgcc
ctggattttgagcaagaaatggctactgctgcatcatcttcctctttggagaagagttat
gagctgcctgatgggcaggtgatcaccattggcaatgagcgcttccggtgtccagaggct
ctcttccagccttccttcctgggcatggagtcctgtggcatccacgagaccaccttcaac
tccatcatgaagtgtgatgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggtggtaccaccatgtatccaggcattgctgacaggatgcagaaggagatcacagccctg
gctcccagcacaatgaagattaagatcattgctcctcctgaacgcaagtactcagtctgg
attggcggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtcaggcccctccattgtccaccgcaaatgcttctag

KEGG   Rattus norvegicus (rat): 81822
Entry
81822             CDS       T01003                                 

Gene name
Actb
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
rno05014  Amyotrophic lateral sclerosis
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05164  Influenza A
rno05205  Proteoglycans in cancer
rno05225  Hepatocellular carcinoma
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05416  Viral myocarditis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81822 (Actb)
   04390 Hippo signaling pathway
    81822 (Actb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    81822 (Actb)
  09143 Cell growth and death
   04210 Apoptosis
    81822 (Actb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81822 (Actb)
   04520 Adherens junction
    81822 (Actb)
   04530 Tight junction
    81822 (Actb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81822 (Actb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81822 (Actb)
   04613 Neutrophil extracellular trap formation
    81822 (Actb)
   04670 Leukocyte transendothelial migration
    81822 (Actb)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    81822 (Actb)
   04919 Thyroid hormone signaling pathway
    81822 (Actb)
  09154 Digestive system
   04971 Gastric acid secretion
    81822 (Actb)
  09159 Environmental adaptation
   04714 Thermogenesis
    81822 (Actb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    81822 (Actb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81822 (Actb)
  09172 Infectious disease: viral
   05164 Influenza A
    81822 (Actb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81822 (Actb)
   05135 Yersinia infection
    81822 (Actb)
   05100 Bacterial invasion of epithelial cells
    81822 (Actb)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81822 (Actb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81822 (Actb)
   05410 Hypertrophic cardiomyopathy
    81822 (Actb)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    81822 (Actb)
   05414 Dilated cardiomyopathy
    81822 (Actb)
   05416 Viral myocarditis
    81822 (Actb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    81822 (Actb)
   03019 Messenger RNA biogenesis [BR:rno03019]
    81822 (Actb)
   03036 Chromosome and associated proteins [BR:rno03036]
    81822 (Actb)
   03029 Mitochondrial biogenesis [BR:rno03029]
    81822 (Actb)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81822 (Actb)
   04147 Exosome [BR:rno04147]
    81822 (Actb)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     81822 (Actb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     81822 (Actb)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     81822 (Actb)
    NuA4 complex
     81822 (Actb)
  Chromatin remodeling factors
   BAF complex
    81822 (Actb)
   PBAF complex
    81822 (Actb)
   SWR1 complex
    81822 (Actb)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    81822 (Actb)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     81822 (Actb)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81822 (Actb)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 81822
NCBI-ProteinID: NP_112406
RGD: 628837
Ensembl: ENSRNOG00000034254
UniProt: P60711
Position
12
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgctcgtcgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccctccatcgtgggccgccctaggcac
cagggtgtgatggtgggtatgggtcagaaggactcctacgtgggcgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccattgaacacggcattgtcaccaactgggac
gatatggagaagatttggcaccacactttctacaatgagctgcgtgtggcccctgaggag
caccctgtgctgctcaccgaggcccctctgaaccctaaggccaaccgtgaaaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtagccatccaggctgtgttg
tccctgtatgcctctggtcgtaccactggcattgtgatggactccggagacggggtcacc
cacactgtgcccatctatgagggttacgcgctccctcatgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgaccgagcgtggctacagcttc
accaccacagctgagagggaaatcgtgcgtgacattaaagagaagctgtgctatgttgcc
ctagacttcgagcaagagatggccactgccgcatcctcttcctccctggagaagagctat
gagctgcctgacggtcaggtcatcactatcggcaatgagcggttccgatgccccgaggct
ctcttccagccttccttcctgggtatggaatcctgtggcatccatgaaactacattcaat
tccatcatgaagtgtgacgttgacatccgtaaagacctctatgccaacacagtgctgtct
ggtggcaccaccatgtacccaggcattgctgacaggatgcagaaggagattactgccctg
gctcctagcaccatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg
attggtggctctatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag
gagtacgatgagtccggcccctccatcgtgcaccgcaaatgcttctag

DBGET integrated database retrieval system