KEGG   Rattus norvegicus (rat): 100361468Help
Entry
100361468         CDS       T01003                                 

Gene name
Gzmbl2
Definition
(RefSeq) Granzyme B-like 2
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
rno04650  Natural killer cell mediated cytotoxicity
rno04940  Type I diabetes mellitus
rno05202  Transcriptional misregulation in cancer
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100361468 (Gzmbl2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100361468 (Gzmbl2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100361468 (Gzmbl2)
  Immune diseases
   05320 Autoimmune thyroid disease
    100361468 (Gzmbl2)
   05330 Allograft rejection
    100361468 (Gzmbl2)
   05332 Graft-versus-host disease
    100361468 (Gzmbl2)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100361468 (Gzmbl2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     100361468 (Gzmbl2)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100361468 (Gzmbl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100361468
NCBI-ProteinID: XP_002728303
RGD: 2320097
Ensembl: ENSRNOG00000045973
UniProt: P18291
Structure
PDB: 

Position
15p12
AA seq 248 aa AA seqDB search
MKLLLLLLSFSLAPKTEAGEIIGGHEAKPHSRPYMAYLQIMDEYSGSKKCGGFLIREDFV
LTAAHCSGSKINVTLGAHNIKEQEKMQQIIPVVKIIPHPAYNSKTISNDIMLLKLKSKAK
RSSAVKPLNLPRRNVKVKPGDVCYVAGWGKLGPMGKYSDTLQEVELTVQEDQKCESYLKN
YFDKANEICAGDPKIKRASFRGDSGGPLVCKKVAAGIVSYGQNDGSTPRAFTKVSTFLSW
IKKTMKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcctcttgctcctgctgagcttctctctggcccccaagacagaggcaggggag
atcatcgggggacatgaagccaagccccactctcgaccctacatggcctatcttcagatc
atggatgagtattctgggagtaagaagtgtggcggcttccttatacgagaagactttgtg
ctgactgctgctcactgttcgggaagcaaaataaatgtcacgttgggggcccacaacatc
aaagaacaggagaagatgcaacaaatcatccctgtggtgaaaatcattccccacccagcg
tataattctaagacaatctccaatgacatcatgctgttaaagctgaagagtaaggccaag
aggtctagcgctgtgaagcctctcaatctgcccagacgcaacgtcaaagtgaaaccagga
gatgtgtgctatgtggctggttggggaaagctgggcccaatgggcaaatactcagacaca
ctacaagaggttgagctaacagtacaggaggatcagaagtgtgagtcctacttaaaaaat
tatttcgacaaagccaatgagatatgtgcaggggacccaaagatcaaacgtgcttccttt
cggggggactctggagggcctcttgtgtgtaaaaaagtggccgcgggcatcgtctcctat
ggacaaaatgatggttcaactccacgggcattcaccaaagtctcgactttcctatcatgg
ataaagaaaactatgaaaaagagctaa

DBGET integrated database retrieval system