KEGG   Rattus norvegicus (rat): 100361529
Entry
100361529         CDS       T01003                                 

Gene name
Rad9a
Definition
(RefSeq) cell cycle checkpoint control protein RAD9A isoform X1
  KO
K10994  cell cycle checkpoint control protein RAD9A [EC:3.1.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100361529 (Rad9a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    100361529 (Rad9a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     100361529 (Rad9a)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    100361529 (Rad9a)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 100361529
NCBI-ProteinID: XP_002728900
RGD: 2319938
Ensembl: ENSRNOG00000018729
UniProt: D3ZXM2
Position
1
AA seq 392 aa
MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQEASPGQDLLRCKILMKSFLSVFRSLATVEKTVEKCCISLSGSNSHLVVQLHCKYGVKK
THNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRS
YQEEEADSTSKAMVTETSIGEEDFQQLHAPEGRAVTFCLKEFRGLLSFAESANLPLTIHF
DVPGRPVIFTVEDSLLDAHFVLATLLEQDSCSQDLCSPKPHQPVPQKQPHSTPHSDDFTN
DDIDCYMIAMETTVGNESSRAQPSTSLPPVPQASHDLAPPSEEEEEEAEPSTVPGTPPPK
KFRSLFFGSILAPIHSPQGPNPVLAEDSDGEG
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaagtgcctgatcactgggggcaacgtgaaggtgctgggaaaggctgtccattcgcta
tcccgaatcggggacgagctctatctggaacccttgaaggacgggctctccctacggact
gtgaactcttcccgttctgcctatgcctgcttcctctttgcccccctcttcttccagcaa
taccaggaagcttcccctggtcaggatctgctgcgctgtaagatcctgatgaagtccttc
ctgtccgtcttccgctctctggcaacggtggagaagactgtggagaagtgctgcatctcc
ctcagtggcagcaacagccacctggtggtccagcttcactgcaaatatggggtcaagaag
acacacaacctctccttccaggactgtgaatccctgcaggctgtcttcgacccagcctca
tgcccccacttactccgcaccccagcacgggttctggcagaggcggttctgtcctttccc
cttgcgttgactgaggtgaccctgggcattggccgtggccgacgcgtcatcctgcgcagc
taccaggaagaggaggcagatagcaccagcaaggccatggtgactgagacgagcattggg
gaggaggacttccagcagctgcatgccccagaagggagagctgtcaccttctgtctcaag
gaatttcgggggctcctgagctttgcagagtctgcaaatttgcctcttactatccacttt
gatgttccaggcaggccagtcatctttaccgttgaggactctttgctagatgcccacttt
gtcttggccacacttttagagcaagactcatgttcccaggacctgtgttccccaaagccc
catcagccagtgcctcagaagcagccacacagcacaccccactcagatgactttaccaat
gatgacatcgactgttacatgattgccatggaaaccaccgtgggcaacgagagctcccgg
gcacagccttccacttccctcccacctgttccccaggcctcccatgaccttgcccctccc
tcagaggaggaagaggaggaagctgagcctagtacagtgcctgggactcccccacccaag
aagtttcgttcacttttctttggctccatcctggcccctatacattccccccagggtccc
aaccctgtgctggctgaagacagtgatggtgaaggctga

KEGG   Rattus norvegicus (rat): 363924
Entry
363924            CDS       T01003                                 

Gene name
Rad9b
Definition
(RefSeq) cell cycle checkpoint control protein RAD9B
  KO
K10995  cell cycle checkpoint control protein RAD9B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    363924 (Rad9b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    363924 (Rad9b)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    363924 (Rad9b)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 363924
NCBI-ProteinID: NP_001025213
RGD: 1308223
Ensembl: ENSRNOG00000021480
UniProt: Q499V3
Position
12
AA seq 398 aa
MTGGQVKVFGKAIQTLSRVSDELWLDPSEKGLALRSVNSCHSTYGYVLFSSVFFQHYQWS
PSATITDSDIPLNLNCKLAIKSILPIFRCLNYLERSIEKCTMVARSDRCRVVIQFFGRHG
IKRTHNVYFQDCQPLKILFEKSLCANILMIKPRLLAEAIALLTSNQEEVTFSVTPENFCL
KSSSGESLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHAPIAIY
FDFPGKPVVLSVEDMLLEASFILATLLDYPSRTSSPQSLRLSQARRSDPTLSGAQEGKSR
VSQTPESISRAAPKRLFPKDPPDSSSAAETRRASASQDDISEVPESVVSDMEEGQSPSPL
RKFSCMFFGAVSCEQQEHANHPLGSLAVASDSEQDASG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacgggcggtcaggtgaaagtgtttgggaaagcaattcaaactctatcacgagtgagc
gatgaactgtggctagacccgtctgaaaaaggtcttgctctgagatctgtgaattcttgt
cattccacatatggctacgtcctgttctcgtctgtgttttttcaacattatcaatggtcc
ccctcagccacgataacagacagtgacataccactgaatttaaattgcaaactggcaata
aagtcaatcctgccaatctttagatgtctgaattaccttgaaagaagcatagagaagtgt
acaatggtcgccagatcggacagatgcagagtcgtcatccagttcttcggcaggcatggt
attaaaagaactcacaatgtgtatttccaagactgccagcccttgaaaattctctttgaa
aagagcttgtgtgcgaacatcctgatgattaaaccaagactgctggctgaggccattgct
cttctaacatcgaatcaagaggaagtcaccttctccgttaccccagagaatttctgcctc
aagagctcgagtggggaatcactggatttaaccagctctgtgtacagtgagatgtctttt
ggcccggaagagtttgacttctttcaggttggacttgataccgagataaccttttgcttt
aaagaactgaaggggatcctcaccttctcagaagtgatgcacgcacccattgccatctac
tttgactttcctggaaaaccagttgttctgagtgtggaagacatgctcttggaggcgagc
tttatcctggccaccttattggactatccaagtagaacatcttcaccacagtcactgcgc
ctttcccaggcacgaaggtcagaccccacactgtccggtgctcaggagggtaaaagccga
gtcagccagaccccagagagcatctctcgagcagcgcccaaaaggctgtttcccaaggat
cctcctgacagcagctctgcagcagagaccaggagagccagcgccagccaggatgacatc
tccgaggtgcctgagagtgttgtcagtgatatggaggaagggcaaagtccctcacccctc
agaaagttttcctgcatgttctttggagcagtatcttgtgaacagcaagagcatgccaac
caccccttgggcagtctggcagtagcaagcgacagtgaacaggacgcgagtggatga

DBGET integrated database retrieval system