KEGG   Rattus norvegicus (rat): 100361543
Entry
100361543         CDS       T01003                                 

Definition
(RefSeq) RhoA activator C11orf59-like
  KO
K20397  ragulator complex protein LAMTOR1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100361543
SSDB
Motif
Pfam: LAMTOR
Other DBs
NCBI-GeneID: 100361543
NCBI-ProteinID: XP_002727613
RGD: 2319924
UniProt: Q6P791
Position
Xq14
AA seq 161 aa
MGCCYSSENEDSDQDQEERKLLLDPSNTPTKALNGAEPSYHSLPSARTDEQALLSSILAK
TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA
SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggggtgctgctatagcagcgaaaacgaggactcggaccaggaccaggaggagaggaag
ctgttgttggaccccagtaacacccctaccaaagccctcaatggagccgagcccagctac
catagcctgccttcagctcgcacagatgagcaggccctgctttcctccatccttgccaag
acagctagcaacatcattgatgtgtctgccgcagactcccagggcatggagcagcatgag
tacatggaccgggcaaggcagtacagtacccgcttggctgtgcttagcagcagtctgacc
cattggaagaagctgccaccgctgccatctctcaccagccagccccaccaagtgctggcc
agtgagcctatccctttctctgacttgcagcaggtctccaggatagctgcttatgcctat
agtgcactttctcagatccgagtggatgcgaaagaagagctggttgtacagtttgggatc
ccatga

DBGET integrated database retrieval system