KEGG   Rattus norvegicus (rat): 100361558
Entry
100361558         CDS       T01003                                 

Definition
(RefSeq) histone H3.3B-like
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100361558
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100361558
  09165 Substance dependence
   05034 Alcoholism
    100361558
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100361558
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100361558
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100361558
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100361558
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100361558
NCBI-ProteinID: XP_002728089
RGD: 2319910
Ensembl: ENSRNOG00000003220
UniProt: P84245 B0BMY8
Position
13q26
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccactggtggtaaagcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtagcactccgagaaatcagacgctatcagaagtccactgaa
cttctgattcgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagacctgcgcttccagagtgcagcgattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system