KEGG   Rattus norvegicus (rat): 100361574
Entry
100361574         CDS       T01003                                 

Gene name
Polr2k
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC4
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100361574 (Polr2k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100361574 (Polr2k)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100361574 (Polr2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100361574 (Polr2k)
   03400 DNA repair and recombination proteins [BR:rno03400]
    100361574 (Polr2k)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     100361574 (Polr2k)
  RNA polymerase III system
   RNA polymerase III
     100361574 (Polr2k)
  RNA polymerase I system
   RNA polymerase I
     100361574 (Polr2k)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100361574 (Polr2k)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 DUF5816 MCM_OB HypA DZR zinc_ribbon_13
Other DBs
NCBI-GeneID: 100361574
NCBI-ProteinID: NP_001269254
RGD: 2319895
Ensembl: ENSRNOG00000010408
UniProt: F1LZN9
Position
7
AA seq 58 aa
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggacacccagaaagatgttcaaccaccaaagcagcagccaatgatatatatttgtgga
gagtgtcacaccgaaaatgaaataaaatccagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaagagattggtggtttttgatgctcgatga

DBGET integrated database retrieval system