KEGG   Rattus norvegicus (rat): 100361574
Entry
100361574         CDS       T01003                                 

Gene name
Polr2k
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC4
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100361574 (Polr2k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100361574 (Polr2k)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100361574 (Polr2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100361574 (Polr2k)
   03400 DNA repair and recombination proteins [BR:rno03400]
    100361574 (Polr2k)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     100361574 (Polr2k)
  RNA polymerase III system
   RNA polymerase III
     100361574 (Polr2k)
  RNA polymerase I system
   RNA polymerase I
     100361574 (Polr2k)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100361574 (Polr2k)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 DUF5816 MCM_OB HypA DZR zinc_ribbon_13
Other DBs
NCBI-GeneID: 100361574
NCBI-ProteinID: NP_001269254
RGD: 2319895
Ensembl: ENSRNOG00000010408
UniProt: F1LZN9
Position
7
AA seq 58 aa
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggacacccagaaagatgttcaaccaccaaagcagcagccaatgatatatatttgtgga
gagtgtcacaccgaaaatgaaataaaatccagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaagagattggtggtttttgatgctcgatga

KEGG   Rattus norvegicus (rat): 117017
Entry
117017            CDS       T01003                                 

Gene name
Polr2g
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB7
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    117017 (Polr2g)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    117017 (Polr2g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    117017 (Polr2g)
   03019 Messenger RNA biogenesis [BR:rno03019]
    117017 (Polr2g)
   03400 DNA repair and recombination proteins [BR:rno03400]
    117017 (Polr2g)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     117017 (Polr2g)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     117017 (Polr2g)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      117017 (Polr2g)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 117017
NCBI-ProteinID: NP_446400
RGD: 621284
Ensembl: ENSRNOG00000019439
UniProt: P62489
Position
1
AA seq 172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttatcatatttccctggagcacgagatcctactgcacccacgctactttggtccc
aacttgctcaacacggtgaagcagaagctgttcaccgaggtggaggggacctgcactggg
aaatatggctttgtgattgctgtcactaccatcgacaatattggtgctggtgtgatccag
ccgggccgaggttttgttctttatccagtgaaatacaaagctattgttttccggcccttt
aaaggggaagtggtggatgctgtggtcactcaggtcaacaaggttggacttttcacagaa
attgggcccatgtcctgcttcatctctcgacactccatcccttcagagatggagtttgat
ccaaattcgaaccccccttgttacaagaccatggatgaggacattgtaattcagcaggac
gatgagatacgcttgaagattgtagggacacgtgtagacaagaatgacatttttgctatt
ggctctctgatggatgactacttgggacttgtgagctga

KEGG   Rattus norvegicus (rat): 288588
Entry
288588            CDS       T01003                                 

Gene name
Polr2j
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB11-a
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    288588 (Polr2j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    288588 (Polr2j)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    288588 (Polr2j)
   03400 DNA repair and recombination proteins [BR:rno03400]
    288588 (Polr2j)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     288588 (Polr2j)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      288588 (Polr2j)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L SHNi-TPR
Other DBs
NCBI-GeneID: 288588
NCBI-ProteinID: NP_001099391
RGD: 1310198
Ensembl: ENSRNOG00000001430
UniProt: D3ZQI0
Position
12
AA seq 117 aa
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaacgcccctccggccttcgagtcgttcttgctcttcgagggcgagaagaaaatcacc
attaacaaggacaccaaggtgcccaacgcttgcttgttcaccatcaacaaagaagaccac
actctggggaacatcattaaatcgcagctgttgaaggacccgcaggtgctgtttgccggc
tacaaagtccctcaccccttggagcacaagatcatcattcgtgtgcagaccaccccagac
tacagcccccaggaggctttcaccaatgccatcacagacctcatcagtgagctctccctc
ctggaggagcgattccgggtggccatcaaggacaagcaagaaggaattgagtag

KEGG   Rattus norvegicus (rat): 289561
Entry
289561            CDS       T01003                                 

Gene name
Polr2b
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB2
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    289561 (Polr2b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    289561 (Polr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    289561 (Polr2b)
   03400 DNA repair and recombination proteins [BR:rno03400]
    289561 (Polr2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     289561 (Polr2b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     289561 (Polr2b)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      289561 (Polr2b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 289561
NCBI-ProteinID: NP_001099472
RGD: 1309477
Ensembl: ENSRNOG00000024779
UniProt: G3V8Y5
Position
14
AA seq 1174 aa
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtatgacgccgacgaggatatgcaatatgatgaagatgatgatgaaatcactccagat
ttgtggcaggaagcatgctggatcgtgatcagttcttattttgatgaaaaaggcttggtc
agacagcagctggattcctttgacgagtttattcagatgtctgttcaaagaattgtggaa
gatgcaccaccgattgacctgcaggctgaagcccagcacgctagtggggaggttgaagag
ccgccaagatatttactgaagtttgaacaaatttacctctccaaacctactcattgggaa
agagatggtgccccttcaccaatgatgccaaatgaagccaggttaagaaatctcacgtac
tccgccccgctttacgtggacataacgaagacggtcattaaagagggtgaagagcagctg
cagactcagcaccagaaaaccttcatcgggaaaatccccattatgctgcgctccacgtat
tgcttgttgaatggcttaacagaccgtgacttgtgtgagctgaatgagtgtcctttggat
cctggtggctattttattattaatggatcagaaaaggttctgatagctcaagagaaaatg
gcaacaaacacagtctatgtgtttgccaaaaaggattccaagtatgcctatacaggagaa
tgccgctcatgcctagagaattcttcccgacccaccagtactatatgggttagcatgctg
gccagaggaggacagggtgcaaagaagagtgcaattggccagcgcatcgtggcgacatta
ccatatatcaagcaagaagttcccatcataattgtgttcagagcattaggctttgtgtct
gatagagatattttagagcacatcatttatgacttcgaagacccagagatgatggaaatg
gttaaaccatctctcgatgaagcatttgtcatccaagagcagaatgttgccttaaacttc
attggttcaagaggggcgaagcctggtgttactaaggagaaaagaattaaatatgcaaaa
gaagtcttacagaaagagatgcttccgcatgtcggtgtcagtgatttctgtgagaccaaa
aaggcctatttcttggggtacatggttcataggttacttctagcagccttgggtagaaga
gaactagatgacagagatcactatggcaacaagagattggatcttgctgggcctctgctt
gcgttcttatttagaggcatgtttaagaatttgctgaaagaagtacggatctatgcacag
aagtttattgaccgcggaaaggactttaacctagagttggcaattaagacaaggatcata
tccgatgggctaaaatactctttagccactgggaactggggtgaccagaagaaagctcac
caagccagagctggagtgtcgcaggtactgaaccgcctgacttttgcgtctactctttct
cacctgcgtcgtttaaactctcctattggcagagatggcaagctagcaaagccgagacag
ttgcataatacattgtgggggatggtgtgtcctgctgaaactccagagggccatgctgta
ggacttgtgaagaatttagccctgatggcttatatttcagttggatctcaaccttctcca
attttggaatttttggaagaatggagcatggaaaacttagaggaaatttcccctgcagct
attgccgatgcaaccaagatttttgttaatggctgctgggttggaatccataaagacccg
gaacaactcatgaacacactcaggaaattacggcgtcagatggacatcattgtatccgaa
gtttctatgatcagagatatccgcgagcgtgagattcggatctatacagacgcaggccgt
atttgtagaccacttctaattgtggaaaagcaaaagcttcttttgaagaagagacacatt
gaccagttgaaagagagagaatataacaactacagttggcaggatctggtagccagtggg
gtagtagagtatattgataccctggaagaagaaaccgtgatgcttgcaatgactccagat
gatttgcaggagaaagaagtagcttattgctccacctatacccactgtgagattcaccca
tcaatgattcttggcgtctgtgcatctattattccttttcctgatcataaccagtcccct
agaaacacgtaccagtctgctatgggcaagcaggctatgggagtttatatcaccaacttc
cacgttcggatggacaccttggcgcacgttctctactatcctcagaagccccttgtgact
acacggtctatggagtatctccggtttagagaactgccagcaggaatcaactcaattgtg
gccattgcatcatacacgggctataatcaagaagactctgttatcatgaatcgttcagct
gtggatcgaggctttttcaggtctgttttctaccgatcatacaaagaacaagagtctaaa
aaaggatttgatcaagaagaagtgttcgagaagcctacacgtgaaacatgtcagggcatg
aggcatgccatttatgacaagttggacgatgatggcttgatagcgccaggggtccgagtg
tcgggagacgatgttattataggcaaaacggtcaccctccctgagaacgaggatgagctg
gagagcaccaacaggcgctacaccaagagggactgcagcaccttcctcagaaccagtgag
acaggcattgtggaccaggtcatggtcactctcaaccaggaaggatataaattttgtaaa
ataagggtacgctctgttagaattccgcagatcggagacaaatttgctagccgacatggt
cagaagggtacttgtggtattcagtatagacaagaggacatgccgttcacttgtgaaggc
ataactcctgacatcatcataaacccccacgccatcccctctcggatgacgattggtcac
ttgattgaatgtctccaagggaaggtctctgcgaacaagggtgaaattggtgatgctact
ccgtttaatgatgctgtcaatgtgcagaagatttctaatcttttatctgactacggctac
catctcagaggaaatgaggtgctctacaatggattcactggtcgcaaaatcacatcgcag
atttttattggccccacttactaccagcgtttgaagcatatggtggatgacaaaattcat
tctcgtgctcgggggcccattcagattcttaacagacagcccatggagggcagatcgcgt
gatggtggcctgcgctttggagaaatggagcgagactgtcagatcgcacatggtgcagca
cagttcttaagagaaaggctgtttgaagcatcagatccgtatcaggttcacgtttgtaat
ctttgtggaataatggcaattgctaacaccaggactcacacatacgaatgcaggggatgc
cgcaataagacccagatctccttggtgcgaatgccgtatgcgtgcaagctgttgttccag
gagctcatgtccatgagcatcgcaccacggatgatgagtgtttag

KEGG   Rattus norvegicus (rat): 292778
Entry
292778            CDS       T01003                                 

Gene name
Polr2i
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB9
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    292778 (Polr2i)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    292778 (Polr2i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    292778 (Polr2i)
   03400 DNA repair and recombination proteins [BR:rno03400]
    292778 (Polr2i)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     292778 (Polr2i)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      292778 (Polr2i)
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Zn_ribbon_recom DZR Ogr_Delta DUF3716 TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 292778
NCBI-ProteinID: NP_001099714
RGD: 1309395
Ensembl: ENSRNOG00000020799
UniProt: D4A531
Position
1
AA seq 125 aa
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
NT seq 378 nt   +upstreamnt  +downstreamnt
atggaacctgacgggacgtacgagcctggcttcgtcggtattcggttctgccaggaatgt
aataacatgctgtaccccaaggaggacaaggagaatcgcattctgctgtacgcgtgccgg
aattgcgattaccagcaggaagccgacaacagctgcatctacgtcaacaaaatcacgcac
gaagtggacgagctgacccagatcatcgcagacgtgtcccaggaccctacgttgccccgg
accgaggaccacccgtgccagaagtgtggccacaaggaggcagtgttcttccagtcacac
agtgcccgagctgaggatgccatgcgcctgtactatgtatgcaccgccccacactgcggc
caccgctggactgagtga

KEGG   Rattus norvegicus (rat): 361365
Entry
361365            CDS       T01003                                 

Gene name
Polr2c
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB3
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361365 (Polr2c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    361365 (Polr2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361365 (Polr2c)
   03400 DNA repair and recombination proteins [BR:rno03400]
    361365 (Polr2c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     361365 (Polr2c)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      361365 (Polr2c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 361365
NCBI-ProteinID: NP_001012491
RGD: 1306935
Ensembl: ENSRNOG00000015720
UniProt: Q5EB90
Position
19
AA seq 275 aa
MPYANQPTVRITELTEENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
NT seq 828 nt   +upstreamnt  +downstreamnt
atgccgtacgccaaccagccaaccgtgcggatcacggaactcactgaagagaacgtcaag
ttcattatcgagaacacggacctggcggtggccaattccattcggagggtcttcatcgca
gaggtgcccataatagccattgactgggttcagattgatgccaactcctcggtccttcat
gatgaattcatcgcgcacaggcttggtttaatccccctcactagtgatgacattgtggac
aagctgcagtactcccgggactgcacatgtgaagagttctgcccagagtgctccgtggag
ttcacgctcgacgtgaggtgcaatgaagaccagacgcgccatgttacctcccgagatctc
atctccaacagcccccgggttatcccggtgacatcccggaaccgggataatgaccccaat
gactatgtggagcaggatgacatccttattgtcaagctgaggaaaggccaggagctgaga
cttcgagcctatgccaagaagggctttggcaaggagcatgccaagtggaaccctactgcg
ggggtagcttttgaatacgatccagacaacgcacttaggcatacagtgtatcccaagcct
gaggaatggccaaagagtgagtactctgagctggatgaggatgagtcacaggctccctat
gaccccaacggcaagccagagaggttttactacaatgtggagtcatgtggctcactgcgc
cctgagaccattgtcctctcagccctgtctgggctaaagaagaagctgagtgatttacag
acccagttaagccatgagatccagagtgacgtgctcaccataaactag

KEGG   Rattus norvegicus (rat): 363633
Entry
363633            CDS       T01003                                 

Gene name
Polr2a
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB1 isoform X1
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    363633 (Polr2a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    363633 (Polr2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    363633 (Polr2a)
   03400 DNA repair and recombination proteins [BR:rno03400]
    363633 (Polr2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     363633 (Polr2a)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     363633 (Polr2a)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      363633 (Polr2a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Other DBs
NCBI-GeneID: 363633
NCBI-ProteinID: XP_343923
RGD: 1587326
Ensembl: ENSRNOG00000028834
UniProt: D4A5A6
Position
10
AA seq 1970 aa
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDVTRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPEDSDEEN
NT seq 5913 nt   +upstreamnt  +downstreamnt
atgcacgggggtggccctccctccggggacagcgcatgcccgctgcgcaccatcaagaga
gtgcagttcggcgtcctgagtccggatgagttgaagcggatgtctgtgacagagggtggt
atcaaatacccagagacaacagagggtggtcgccccaaacttgggggactaatggatcca
cgacagggggtgattgagcggactggccgttgtcaaacatgtgcaggaaacatgaccgag
tgtcctggccactttggccacattgaactggccaagcctgtgtttcatgtgggcttcctg
gtgaagacaatgaaggttttgcgctgtgtctgcttcttttgctccaaacttcttgtagat
tctaacaacccgaagattaaggacatcctggccaaatctaaggggcagcccaagaaacgg
cttacacatgtctatgacctttgcaagggcaaaaacatctgtgaaggtggagaggagatg
gacaacaagtttggtgtggagcagcctgagggggatgaggatctgaccaaagaaaagggc
catggtggctgtgggcgttatcagccccggatccggcgctctggcctggagttgtatgct
gaatggaaacatgttaatgaggactctcaggagaagaagatcttgctgagtccagaacga
gtgcatgaaatcttcaaacgcatctcagatgaggagtgttttgtgctgggcatggagcct
cgctatgcccggcctgagtggatgattgtcacggtgttgcctgtgcctcctctctctgtg
cgacctgctgtggtgatgcaaggttctgctcgaaaccaggatgatctgactcacaaactg
gctgacattgtgaagatcaacaatcagctgcggcggaacgaacagaatggtgcagctgcc
catgtcatcgcagaagatgtgaaacttctccagttccatgtggccaccatggtggacaac
gaactgcccggcttaccccgtgccatgcagaagtctggccgtcccctcaagtccctgaag
caacggttgaagggcaaggaaggacgggttcgagggaatctaatgggcaagcgagtggac
ttctcagcccgcactgtcatcacccctgaccctaacctatccattgaccaagttggtgtg
ccccgctccattgctgccaacatgacctttgcagagattgtcacacctttcaacattgac
agacttcaggaattagtacgcaggggaaacagccagtatccaggagccaagtacatcatc
cgagacaacggtgatcgaattgacttacggttccatcctaagcccagtgaccttcaccta
cagactggctataaggtggaacggcacatgtgtgatggggacattgttatcttcaatcgt
cagccaactttgcacaaaatgtccatgatggggcatcgggtccgcatcctcccctggtct
acatttcgcttgaatcttagtgtgacaactccatacaatgcagactttgatggagatgag
atgaatttgcacctgcctcagtctctggagacacgggcagagatccaagagttggccatg
gtacctcgaatgattgtcactccccagagcaatcgacctgtcatgggtattgtgcaagac
acactcacagcggtccgcaaattcactaagagagatgtcttcctggagcggggtgaagtg
atgaacctcttaatgttcctgtccacgtgggatgggaaggtcccacagccagccatcctc
aagccccggcccctgtggacaggcaagcaaatcttctccctcatcatacctggtcacatc
aattgtatccgtactcacagcacccatcctgatgatgaagatagtggcccttacaagcac
atctctcctggggacaccaaagtggtggtggagaatggggagcttatcatgggcatcctt
tgtaagaagtctctgggcacatcagcaggctctctggtccacatctcctacttagagatg
ggtcatgacgttacccgcctcttctactccaacattcagactgtcattaacaactggctt
ctcatcgagggtcataccattggcattggggactccattgcagattccaagacttaccag
gacattcagaacactattaagaaagctaaacaggatgtaatagaggtcattgagaaggct
cataacaatgagctagaacccaccccaggaaacacattgcgccagacatttgagaatcaa
gtgaatcgcattctcaatgatgctcgagacaaaactggctcctctgcacagaaatccctc
tctgaatataacaacttcaagtctatggtggtgtctggagctaaagggtccaagatcaac
atctcccaggtcattgccgttgtcgggcagcagaacgtggagggcaagcggatcccattt
ggatttaagcatcggactcttcctcactttatcaaggatgattatggtcccgagagccga
ggctttgtagaaaactcctacttggctggcctcactcccactgagttcttcttccatgcc
atgggaggacgagaaggtctcattgacacagctgttaagactgctgagactgggtatatt
cagcgaaggctgataaaatccatggagtcggtgatggtgaaatatgatgcaactgtgagg
aactccatcaaccaggtggtacagctacgctatggagaggacggcctagcaggcgagagc
gttgagttccagaatctggctacacttaagccttctaataaagcttttgagaagaagttc
cgttttgattataccaatgagagggccctgcggcggactcttcaggaggatctggtaaag
gatgtgctgagcaatgcccacatacagaatgagctagaacgggaatttgaacggatgcgg
gaagatcgggaagtgctcagggtcatcttcccaactggtgacagcaaggtggtcctccct
tgtaaccttctgcggatgatctggaatgcacagaaaatcttccatatcaaccctcgcctt
ccctctgacctgcaccccatcaaagtggtagagggagtcaaagaattgagcaagaagttg
gtaattgtgaatggagatgacccactaagtcggcaggcacaggagaatgccactttgctc
ttcaacatccacctaagatccacactttgctctcgccgaatggctgaggagtttcggctc
agtggagaggcctttgactggctgctcggggagatagagtccaagttcaaccaagccatt
gcccatcctggagaaatggtgggagctttggctgctcagtctcttggagaacctgccact
cagatgaccctgaacactttccactatgctggtgtatctgccaagaatgtgacgctgggt
gtacctcggcttaaggagctcatcaacatctctaagaagccaaagaccccttcactcact
gtcttcctgttaggccaatctgcccgagacgctgagcgggccaaggacattctttgccgc
ttggaacatacaacattgaggaaggtgactgccaacacagccatctactatgaccccaac
cctcagagcacagtggtggcagaagatcaggagtgggtgaatgtgtactatgagatgcct
gactttgatgtagcccgaatatccccctggctgctgcgtgtggaactggaccgaaagcac
atgactgaccggaagcttaccatggaacagattgctgaaaaaatcaatgcaggctttggc
gatgatttgaattgtatcttcaatgatgataatgcagagaagctggtccttcgtatccgc
atcatgaacagtgatgaaaacaagatgcaggaggaggaagaggtggtggataagatggat
gatgatgttttcctgcggtgcattgagtccaacatgctgacagatatgaccctgcagggt
attgagcagatcagcaaggtatacatgcacttacctcagacagacaacaagaagaagatc
atcatcacagaagatggggagttcaaggccctgcaagaatggatcttggagacagatggt
gtgagcctgatgcgggtgctgagcgagaaggatgtagaccctgtgcgcactacgtccaat
gacatcgtggagatcttcacggtactgggcattgaggctgtgcggaaggccctggagcga
gaactgtaccatgtcatctcctttgatggttcctacgtcaattatcggcatttggctctt
ctgtgtgacacaatgacatgccgtggccacttgatggccatcactcgtcatggagtcaac
cgccaggacactggaccactcatgaaatgctcctttgaggaaacggtggatgtccttatg
gaagcagctgcacatggggagagtgaccccatgaagggagtctctgagaatattatgctg
ggccagctcgctccagctggtactggctgttttgacctcctgcttgatgctgagaaatgc
aaatacggcatggaaatccccaccaatatccccggactgggggccgctggacctactggc
atgttctttggctctgcacccagtccgatgggaggaatctctcctgcaatgacaccctgg
aaccagggtgcaactccagcctatggtgcctggtccccaagtgttgggagtgggatgacc
ccaggagcagctggcttctctcccagtgctgcatctgatgccagtggcttcagcccaggt
tactcgcctgcatggtctcccacaccaggctctccaggctcccctggaccctcaagccca
tatatcccctcaccaggtggtgctatgtctcccagctactcaccaacatcaccagcatat
gagccgcgctcccctgggggctatacaccgcagagcccctcatactcccctacttctcct
tcctactccccaacgtctccgtcttattctccaaccagtcccaactatagtcctacctca
cctagctactccccaacctctcctagctattccccaacctctccatcctactcaccaacc
tctccatcctactcaccaacctctcccagctactccccaacctctcccagctactcccca
acatcacccagctattctccaacttctcccagctactcaccaacatctcctagctattcc
ccaacatctcccagctactcaccaacctctccaagctattctcccacctcccccagttac
tcaccgacatctccaagctactcaccaacttctccaagttactcaccaacttccccaagt
tactcacccactagccctaactattccccaactagtcccaactataccccaacctcaccc
agctacagcccaacctcacccagctactcacctactagtccaaactatacacctaccagc
cctaactacagcccaacctctccaagctattccccaacctcacccagttactctcccacc
tcacccagctactctccctcgagcccacggtatacacctcagtctccaacctacacaccg
agttcaccaagctacagccctagctcgccaagctacagccctacttcccccaagtatacc
ccaactagtccttcctacagtcctagctcaccagagtataccccaacttctcccaaatac
tcacctacaagccccaaatattcacccacttctcccaagtattctcctaccagccccact
tactcacccaccaccccaaaatactcgccaacctctcctacatattcaccaacctctcca
gtctacaccccgacctctcccaagtactcccctactagtcctacctactccccaacttct
cccaagtactcgcccaccagtcccacctactcacccacctctcccaagggctccacctac
tctcccacttctcctggctactcccccaccagccccacctacagcctcaccagtccagcc
atcagcccagaagacagcgatgaggagaactga

KEGG   Rattus norvegicus (rat): 364834
Entry
364834            CDS       T01003                                 

Gene name
Polr2d
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB4
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    364834 (Polr2d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    364834 (Polr2d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    364834 (Polr2d)
   03400 DNA repair and recombination proteins [BR:rno03400]
    364834 (Polr2d)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     364834 (Polr2d)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      364834 (Polr2d)
SSDB
Motif
Pfam: RNA_pol_Rpb4 Maelstrom Tfb4
Other DBs
NCBI-GeneID: 364834
NCBI-ProteinID: NP_001102356
RGD: 1308565
Ensembl: ENSRNOG00000016231
UniProt: D4A259
Position
18
AA seq 142 aa
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggcaggtggaagcgatcctcgagctggcgacgtagaagaagatgcttcccagctc
atctttcccaaagagttcgaaacagctgagacgctcctgaactctgaagttcacatgctt
ctggagcaccgaaagcagcagaatgagagtgcggaggacgaacaggagctttcagaggtt
ttcatgaaaaccctgaactatacagcccgtttcagccggttcaaaaacagagagaccatt
gccagtgttcgtagcctgcttctccagaagaagttacataagtttgaattggcttgttta
gccaatctgtgcccggagactgctgaggagtccaaagcgctgattccaagcctggaaggg
cgttttgaagatgaggaactgcagcagattcttgatgatatccagacgaagcgcagcttc
cagtactga

KEGG   Rattus norvegicus (rat): 498109
Entry
498109            CDS       T01003                                 

Gene name
Polr2h
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide H
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    498109 (Polr2h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    498109 (Polr2h)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    498109 (Polr2h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    498109 (Polr2h)
   03400 DNA repair and recombination proteins [BR:rno03400]
    498109 (Polr2h)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     498109 (Polr2h)
  RNA polymerase III system
   RNA polymerase III
     498109 (Polr2h)
  RNA polymerase I system
   RNA polymerase I
     498109 (Polr2h)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      498109 (Polr2h)
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 498109
NCBI-ProteinID: NP_001128261
RGD: 1561203
Ensembl: ENSRNOG00000049116
UniProt: G3V678
Position
11
AA seq 150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcgggcatcctgttcgaggatattttcgatgtgaaagacattgacccagaaggcaag
aaatttgaccgagtatcccgtctgcattgtgagagtgaatctttcaagatggacctcatc
ttagatgtaaacattcagatttaccctgtagacttaggtgacaagttccggttggttata
gctagtactttgtatgaagatggtaccttggatgatggtgaatacaaccccacagacgac
aggccttccagggctgaccagtttgagtatgtaatgtatgggaaagtgtacaggatcgaa
ggggacgagacctcaacggaagcagccacacgtctctctgcgtatgtgtcctatggcggc
ctcctcatgaggcttcagggggacgccaacaacctgcatggatttgaggtggactcccga
gtctacctgctgatgaagaagctggcgttctga

KEGG   Rattus norvegicus (rat): 502374
Entry
502374            CDS       T01003                                 

Gene name
Polr2l
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    502374 (Polr2l)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    502374 (Polr2l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    502374 (Polr2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    502374 (Polr2l)
   03400 DNA repair and recombination proteins [BR:rno03400]
    502374 (Polr2l)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     502374 (Polr2l)
  RNA polymerase III system
   RNA polymerase III
     502374 (Polr2l)
  RNA polymerase I system
   RNA polymerase I
     502374 (Polr2l)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      502374 (Polr2l)
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 502374
NCBI-ProteinID: NP_001137383
RGD: 1566209
Position
1
AA seq 67 aa
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatcccagttcgctgcttcacctgcgggaagatcgtcggtaacaaatgggaagcc
tacctgggtctgctacaggcagagtacaccgagggggatgccctggacgctctgggcctg
aagcgttactgctgccgccgcatgctgctcgcacacgtggacctgattgagaaactgctg
aactatgcacccctagagaagtga

KEGG   Rattus norvegicus (rat): 681193
Entry
681193            CDS       T01003                                 

Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    681193
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    681193
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    681193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    681193
   03400 DNA repair and recombination proteins [BR:rno03400]
    681193
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     681193
  RNA polymerase III system
   RNA polymerase III
     681193
  RNA polymerase I system
   RNA polymerase I
     681193
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      681193
SSDB
Motif
Pfam: RNA_pol_N Chordopox_RPO7
Other DBs
NCBI-GeneID: 681193
NCBI-ProteinID: XP_038964475
RGD: 1583498
Position
4
AA seq 67 aa
MIIPVCCFTCGKIIGNKWEAYLGLLQAMYTEGDALDTLDLKRYCCRCMLLAHADLIEKLL
NYALLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatcccagtttgctgcttcacctgcgggaagatcattggtaacaaatgggaagcc
tatctgggtctgctgcaggccatgtacaccgagggggatgccctggacactctggacctg
aagcgctactgctgccgctgcatgctgctcgcacacgcggacctgattgagaaactgctg
aactatgcactcctagagaagtga

KEGG   Rattus norvegicus (rat): 690966
Entry
690966            CDS       T01003                                 

Gene name
Polr2e
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC1
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    690966 (Polr2e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    690966 (Polr2e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    690966 (Polr2e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    690966 (Polr2e)
   03400 DNA repair and recombination proteins [BR:rno03400]
    690966 (Polr2e)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     690966 (Polr2e)
  RNA polymerase III system
   RNA polymerase III
     690966 (Polr2e)
  RNA polymerase I system
   RNA polymerase I
     690966 (Polr2e)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      690966 (Polr2e)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 690966
NCBI-ProteinID: NP_001103084
RGD: 1589817
Ensembl: ENSRNOG00000013545
UniProt: B0BNE2
Position
7
AA seq 210 aa
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atggacgacgaggaggaaacgtatcggctgtggaagatccgcaagactatcatgcagctg
tgtcatgaccgaggctacctggtgacccaggatgagctggaccagacacttgaagagttc
aaggcacagtttggggacaagcccagcgaaggacggccgaggcgcacagacctcaccgtg
ctggtggcccacaacgatgatcccacagaccagatgtttgtcttcttcccagaggagccc
aaggtgggcatcaagaccatcaaggtgtactgccagcgcatgcaggaggagaacatcaca
cgggcgctgatcgtggtgcagcagggcatgacaccctccgccaagcagtccctggtagac
atggcccctaagtacgtgctagaacagtttctacagcaggagctgctcatcaatatcaca
gaacatgagctagtccctgagcacgtggtcatgaccaaggaggaggtgacggaactgctg
gcgcgatacaagctccgtgagagccagctgcccaggatccaggctggggacccggtggca
cggtacttcgggatcaagcgagggcaggttgtgaagattatccgccccagtgagacagcc
ggccggtacatcacctaccgcctggtgcagtag

KEGG   Rattus norvegicus (rat): 83503
Entry
83503             CDS       T01003                                 

Gene name
Polr2f
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC2
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    83503 (Polr2f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    83503 (Polr2f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    83503 (Polr2f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    83503 (Polr2f)
   03400 DNA repair and recombination proteins [BR:rno03400]
    83503 (Polr2f)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     83503 (Polr2f)
  RNA polymerase III system
   RNA polymerase III
     83503 (Polr2f)
  RNA polymerase I system
   RNA polymerase I
     83503 (Polr2f)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      83503 (Polr2f)
SSDB
Motif
Pfam: RNA_pol_Rpb6 BDHCT_assoc
Other DBs
NCBI-GeneID: 83503
NCBI-ProteinID: NP_112625
RGD: 708567
Ensembl: ENSRNOG00000011214
UniProt: O88828
Position
7
AA seq 127 aa
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcagacaacgaagacaatttcgatggcgatgactttgatgacgtggaggaggacgaa
gggcttgacgacttggaaaatgctgaggaggagggtcaggaaaatgttgagattctccca
tctggtgaacgaccgcaggccaaccagaagcgtatcaccactccatacatgaccaagtac
gagcgagcccgagtgctgggcacccgggctctccagattgcgatgtgtgccccagtaatg
gtggagctggagggggagacagaccctttgctcatcgccatgaaggaactcaaggcccgg
aagatccccatcatcattcgccgttacctgccagatggaagctatgaggattggggcgtg
gatgagctcatcatcagcgactga

DBGET integrated database retrieval system