KEGG   Rattus norvegicus (rat): 100361631
Entry
100361631         CDS       T01003                                 

Gene name
Tmem35b, Zmym6nb
Definition
(RefSeq) transmembrane protein 35B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DoxX_2 DoxX
Other DBs
NCBI-GeneID: 100361631
NCBI-ProteinID: NP_001258066
RGD: 2319741
Ensembl: ENSRNOG00000028083
UniProt: D3ZYP5
Position
5q36
AA seq 152 aa
MLVSLGALRVLLGIFFTLTGAAKLFQVSAPVSQQMKALFEQFAEVFPLKVLGYQPDPISY
QAAVGWLELLAGLLLVVGPPVLQQISNVLLILLMMGAVFTLVVLEESLSTYIPAVVCLGL
LLLLDSCQFLVRTKGAVRCRNKIPGALGNPRK
NT seq 459 nt   +upstreamnt  +downstreamnt
atgctggtcagtctaggcgcattgcgagttctgcttggcatctttttcactctcaccggg
gctgccaagctctttcaggtctcggcccccgtgtcacaacaaatgaaagccttgttcgag
cagtttgctgaggtgttcccgttgaaggtgttgggctaccagccagatcctataagctac
caagcagctgtgggctggctggaactgctggctgggttgctgctggtcgtgggtccacct
gtgctacagcagatcagtaacgtgctcttgatcctcctcatgatgggggctgtcttcact
ttggtggtcctggaagagtcactgagtacttatatcccagctgttgtctgtctggggctc
ctgctgctgctggattcctgccagttcttagttcgaactaaaggagcggtcagatgccgt
aacaaaatccctggtgcacttgggaaccctaggaagtga

DBGET integrated database retrieval system