KEGG   Rattus norvegicus (rat): 100361818
Entry
100361818         CDS       T01003                                 

Gene name
Nfatc1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04921  Oxytocin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05135  Yersinia infection
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100361818 (Nfatc1)
   04310 Wnt signaling pathway
    100361818 (Nfatc1)
   04024 cAMP signaling pathway
    100361818 (Nfatc1)
   04022 cGMP-PKG signaling pathway
    100361818 (Nfatc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100361818 (Nfatc1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100361818 (Nfatc1)
   04650 Natural killer cell mediated cytotoxicity
    100361818 (Nfatc1)
   04660 T cell receptor signaling pathway
    100361818 (Nfatc1)
   04658 Th1 and Th2 cell differentiation
    100361818 (Nfatc1)
   04659 Th17 cell differentiation
    100361818 (Nfatc1)
   04662 B cell receptor signaling pathway
    100361818 (Nfatc1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100361818 (Nfatc1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100361818 (Nfatc1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100361818 (Nfatc1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100361818 (Nfatc1)
   05170 Human immunodeficiency virus 1 infection
    100361818 (Nfatc1)
   05161 Hepatitis B
    100361818 (Nfatc1)
   05163 Human cytomegalovirus infection
    100361818 (Nfatc1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100361818 (Nfatc1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100361818 (Nfatc1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100361818 (Nfatc1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100361818 (Nfatc1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100361818 (Nfatc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100361818 (Nfatc1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100361818 (Nfatc1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100361818
NCBI-ProteinID: NP_001231862
RGD: 2319357
Ensembl: ENSRNOG00000017146
Position
18
AA seq 827 aa
MPSTSFPVPSKFPLGPPAAVCGSGETLRPAPLAGGTMKAAEEEHYSYASPSVTSTLPLPT
AHSALPAACHDLQTSTPGISAVPSANHPSGYGGAVDSGPSGYFLSSGNTRPNGAPTLESP
RIEITSYLGLHHGSNQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLS
SRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSP
STSPRASVTEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTED
TWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVSIKSRKTALEHVPSVALKVEPAGEDLG
TTPPTSDFPPEEFAFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQL
PSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPVVQLHGYLENEPLTLQLFIG
TADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGILKL
RNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGRTLSLQVASNPIECSQRSAQELPLVE
KQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVLE
IPPFRNQRITSPVQVSFYVCNGKRKRSQYQHFTYLPANVPIIKTEPTDDFEPALTCGPMS
QGLSPLPRPYYSQQLTAPPDPGSCLVAGFAPCSQRNTPMPTSPNASPKLHDLSSPAYAKG
LANPGHSGHLGLQPPASEAPTMQELPRPMAVQPNSPEQPTSVRLQPQ
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgccaagtaccagctttccagtcccttccaagtttccactcggccctccggccgcagtc
tgcgggagcggagaaactttgcggcccgcgccgctcgccggcggcaccatgaaggcggcc
gaggaagaacactacagttatgcgtcccctagcgtcacctcaactctgccccttcccaca
gcacactccgccttgccagcggcatgccatgacctccagacgtccaccccgggcatctca
gctgttccttcggccaatcacccctctggttatgggggcgctgtggacagtgggccttca
ggatacttcctgtcctccggcaacacgagacccaatggggccccgactctcgagagtcct
cgaatcgagatcacctcctatctgggccttcaccacggcagcaaccaatttttccacgat
gtggaggtggaagacgtacttcctagctgcaagcggtcaccatctacagcaaccctgcac
ctgcccagtctggaagcctacagagacccctcctgcctgagcccagccagcagcctgtcc
tccaggagctgtaactctgaggcgtcctcctatgagtccaactattcatacccgtacgca
tccccccagacctctccatggcagtcaccctgtgtgtctcccaagaccacggacccagag
gagggctttccccgaagcctgggtgcctgccacttgctgggatcgccaaggcactcccca
tccacctctcctcgtgcaagcgtcaccgaggagagctggctcggtgcccgtggctcccgg
cccacatccccctgcaacaagcgcaaatacagtctcaacggcaggcagccctcctgctca
ccccaccactcgcccacaccatccccccatggctcccctcgggtcagcgtgacggaagac
acctggcttggtaacaccacccagtacaccagctctgctattgtggcagccatcaacgcc
ctgaccactgatagcactctggacctgggtgacggtgtctctatcaagtctcgaaagaca
gccctggagcacgtgccctctgtggccctcaaggtagagccggctggggaagacctgggc
accacaccacccacttctgacttcccacccgaggagttcgccttccagcaccttcggaag
ggtgccttttgtgagcagtatctgtcggtgccacaggcctcgtatcagtgggcaaagccc
aagtctctatccccaacgtcatacatgagcccatccctgcctgcccttgactggcagctg
ccgtcgcactctggtccgtatgaactccggatcgaggtgcaacccaagtctcaccacagg
gctcactatgagacggaaggcagccggggagctgtgaaggcttctgctggaggacaccct
gtcgtgcagctacatggttacttggaaaacgagcctctcacgctccagctgttcattggg
acggctgacgaccgcctgctacggccccatgccttctaccaggtccaccggatcacgggg
aagactgtctccaccaccagccacgaggctatcctgtccaacaccaaagtcctggagatc
ccactgcttccagaaaataacatgcgagccatcatcgactgtgctgggatcctgaagctc
agaaactctgatatcgagctgaggaaaggggagacagacatcgggagaaagaacaccagg
gtgcggctggtcttccgagtccacatcccccagcccagcggccggacgctgtctctccag
gtggcctcaaacccgatcgagtgctcccagcggtcggcccaggaactgcccctcgtggag
aagcagagcacagacagctacccggtcattggagggaagaagatggtgttgtctggccat
aactttctgcaagactccaaggtcatcttcgtggagaaggccccagatggccaccatgtc
tgggagatggaagcgaaaactgaccgagacctgtgcaagccaaattccctggtgctggag
ataccacctttccgcaaccagagaataaccagccccgtccaagtcagcttctatgtctgc
aacgggaagcggaagagaagccagtaccagcatttcacgtaccttcctgccaatgttcca
attataaagacagaacccacggacgactttgagccagctctgacctgtggaccaatgagc
cagggacttagccctctgccgaggccttactatagccaacaactcaccgcgcctcctgac
cctggctcctgccttgtggccggctttgccccctgctcacagaggaacacgccgatgccc
acgtctcccaatgcaagcccaaagctccacgacctttcctctcccgcctacgccaagggc
ctcgccaacccaggccacagtggtcaccttggacttcagccaccagcttcagaggccccc
accatgcaggaattgccgagacccatggccgtccagcccaactcgcctgagcagcccaca
tccgtcaggctacagccgcagtaa

KEGG   Rattus norvegicus (rat): 305897
Entry
305897            CDS       T01003                                 

Gene name
Nfatc4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04625  C-type lectin receptor signaling pathway
rno04921  Oxytocin signaling pathway
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    305897 (Nfatc4)
   04022 cGMP-PKG signaling pathway
    305897 (Nfatc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    305897 (Nfatc4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    305897 (Nfatc4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    305897 (Nfatc4)
  09158 Development and regeneration
   04360 Axon guidance
    305897 (Nfatc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    305897 (Nfatc4)
   05170 Human immunodeficiency virus 1 infection
    305897 (Nfatc4)
   05161 Hepatitis B
    305897 (Nfatc4)
   05163 Human cytomegalovirus infection
    305897 (Nfatc4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    305897 (Nfatc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    305897 (Nfatc4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    305897 (Nfatc4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 305897
NCBI-ProteinID: NP_001100734
RGD: 1310749
Ensembl: ENSRNOG00000020482
UniProt: D3Z9H7
Position
15
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGPGGPGEELDSEDAPPCCRLALGEPLPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPPRSVRLGGPGGTAGGTGGGRVLECPSIRITS
ISPTPDPPTSLEDAPETWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLSSPLPSPRASPRPWTPEDPWSLYGPSSGG
RAPEDSWLLLSAPGPIPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLVRDPSSSGPFDYVGAPPTESVPQKTRRTSSEQAVALPRSEEPASCNGKLPSGTED
SVAAPGALRKEMAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYNEKPLTLQMFIGTADERSLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEAAVNRLQSSEVTLTLTIPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSTSGPPFGPDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFGYSTPALYPQTGPPPSYRSGLRMFPETGGTTGCARLPSV
SFLPRPFPGDQYGGQGSSFPLGLPFSPPAPFRPPLPSSPPLEDPFNPQSAVHPLPAEGYN
EVGPGYTPGEGASEQEKSRGGYGSGFRDNVPIQGITLEEVSEIIGRDLSGFPARPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcggcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggccctgggggccctggggaagagctggactcggaggatgcc
cctccgtgctgtcgtttggccctgggggaaccccttccttatggtgctgcccctattggt
attccccgacccccaccccctcggccagggatgcactcaccaccaccccgtcctgcccct
tcacctggcacctgggagagccagccacctcggtcggtgaggctggggggcccaggaggc
actgcggggggtactgggggcggtcgtgttcttgagtgtcccagcatccggatcacctct
atctctcccacgcctgacccaccgacctcactagaggatgctcctgaaacttggggggac
ggctctcctagagattaccctccaccagaaggctttgggggctaccgagaggctggaggt
cagggcggaggagccttcttcagcccgagccctggcagcagcagcctgtcttcgtggagc
ttcttctctgatgcctcagacgaggcagccctgtatgcagcatgcgacgaagtggagtct
gaacttaatgaagcagcctctcgtttcggcttgagctctccactgccctcgccccgggct
tctcctaggccatggaccccggaggatccgtggagcctatatggtccaagctccggaggc
cgagcgccagaggatagctggctacttctcagcgctcctgggcccatcccagcctcccct
cggcctgcttctccctgcggcaagcggcgctattccagttccggaaccccatcttcggcc
tccccagctttgtcccgccggggtagccttggggaagagggtccagagccacctccacca
cccccattgcctctggtccgggaccctagttcctctggcccttttgactatgtgggtgct
ccaccaaccgagagcgtccctcagaaaaccaggaggacttctagcgagcaagcagtggcc
ttgcctcggtctgaggagcctgcctcgtgcaatgggaagctgccctctggtacagaggac
tccgtggctgctcccggggctctgcggaaagagatggctggcatggattacttagcagtt
ccttctcccctcgcttggtccaaggcccggattgggggacacagccccatcttcaggacc
tctgccctacctcccctggactggcctttacccagccagtacgagcagctggagctgagg
attgaggtgcagcccagagctcaccaccgagctcattatgagactgagggcagccgggga
gctgtcaaagctgctcctggaggtcaccctgtggtcaagctcctaggctacaatgagaag
ccattgactcttcagatgttcattggcactgcagacgagaggagcctgcggccccatgcc
ttctaccaggtgcaccggatcactggcaagatggtggctacagccagctatgaagctgta
gtcagtggtactaaagtgttggagatgactttgctcccagagaacaacatggctgccaac
attgactgtgctggaatcctgaagcttcggaattcagacattgagctacggaagggcgag
acagacatcgggcgcaaaaacacacgtgtgcgactggtgttccgtgtgcatgtgcctcag
ggcggcgggaaggtcgtctctgtgcaggcagcatcggtgcccatcgagtgctcccagcgc
tcagcccaggagctgccccaagtggaggcctacagccccagtgcctgctccgtgagagga
ggggaggagctagtgttgactggatccaacttcctgccagactctaaagtggtgttcatt
gagaggggccctgatggaaaactgcagtgggaggaagaggccgcagtgaaccggctgcag
agcagtgaggtgacactgactctgaccatccctgagtacagcaacaagcgggtgtcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaagcgcagtcccacccaaagt
ttcaagttcctgcctgtgatcttcaaggaggagcccctaccagactcatctctccggggc
ttcccttccacatcgggtcccccctttggccccgacatggacttctcaccgcccaggccc
ccttatccctcctatccccatgaagaccctgcttatgagactccttatctgtcagaaggc
tttggttatagcacacccgctctgtacccccagacagggcccccaccgtcttatagatct
ggcctacggatgttccctgagactgggggtaccacaggttgtgcccgcctaccttcagtc
tcctttcttccgcgcccctttcctggtgatcagtatggaggacagggctcctcttttccc
ctggggcttccattctcccctccggccccctttaggcctccattaccttcctccccacca
ctcgaagacccctttaacccccagagtgctgtccaccccttacctgctgagggctacaat
gaggtggggccaggctatacccctggggagggggcttcggagcaggagaaatccaggggt
ggctacggcagcggcttcagagacaatgtgcctatccagggtatcaccctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacgtcctggagaagagcctcct
gcctga

KEGG   Rattus norvegicus (rat): 311658
Entry
311658            CDS       T01003                                 

Gene name
Nfatc2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04921  Oxytocin signaling pathway
rno05135  Yersinia infection
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    311658 (Nfatc2)
   04370 VEGF signaling pathway
    311658 (Nfatc2)
   04022 cGMP-PKG signaling pathway
    311658 (Nfatc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    311658 (Nfatc2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    311658 (Nfatc2)
   04650 Natural killer cell mediated cytotoxicity
    311658 (Nfatc2)
   04660 T cell receptor signaling pathway
    311658 (Nfatc2)
   04658 Th1 and Th2 cell differentiation
    311658 (Nfatc2)
   04659 Th17 cell differentiation
    311658 (Nfatc2)
   04662 B cell receptor signaling pathway
    311658 (Nfatc2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    311658 (Nfatc2)
  09158 Development and regeneration
   04360 Axon guidance
    311658 (Nfatc2)
   04380 Osteoclast differentiation
    311658 (Nfatc2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    311658 (Nfatc2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    311658 (Nfatc2)
   05170 Human immunodeficiency virus 1 infection
    311658 (Nfatc2)
   05161 Hepatitis B
    311658 (Nfatc2)
   05163 Human cytomegalovirus infection
    311658 (Nfatc2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    311658 (Nfatc2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    311658 (Nfatc2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    311658 (Nfatc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    311658 (Nfatc2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    311658 (Nfatc2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 311658
NCBI-ProteinID: NP_001101275
RGD: 1307690
Ensembl: ENSRNOG00000012175
UniProt: D4A0I8
Position
3
AA seq 931 aa
MDAPEPQSDPDGGDGPGHEPGGSSQDELDFSILFDYDYLNPIEEEPIAHKAISSPSGLAY
PDDVLDYGLKPCNPLASLSGEPPGRFGESDSIGFQNFLSPAKPAGASGPSPRIEITPSHE
LMQAGGALRGRDAGLSPEQPALALAGMAASPRFTLPVPGFEGYREPLCLSPASSGSSASF
ISDTFSPYTSPCVSPNNAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPV
PRPASRSSSPGAKRRHSCAEALVAPLPAASPQRSRSPSPQPSPHVAPQDDGIPAGYPPTA
GSAVLMDALNSLATDSPCGIPSKIWKTSPDPTPVSTAPSKAGLARHIYPAVEFLGPCEQE
ERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSNQSGSYELRIEVQPKP
HHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRK
NTRVRLVFRVHIPEPSGRIVSLQAASNPIECSQRSAHELPMVERQDMDSCLVYGGQQMIL
TGQNFTAESKVVFMEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRVPVKVNF
YVINGKRKRSQPQHFTYHPVPAIKTEPSDEYEPSLICSPAHGGLGSQPYYPQHPMLAESP
SCLVATMAPCQQFRSGLSSPDARYQQQSPAAALYQRSKSLSPGLLGYQQPSLLAAPLGLA
DAHRSVLVHAGSQGQGQGQGSTLPHTSSASQQASPVIHYSPTNQQLRGGGHQEFQHIMYC
ENFGPSSVRPGLPPVNQGQRLSPGSYPTVIQQQTAPSQRAAKNGPPVSDQKEALPSGVTV
KQEQNLDQTYLDDVNEIIRKEFSGPPSRNQT
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggacgccccggagccgcagtccgaccccgacggcggggacggccccggccacgagccc
gggggcagttcccaagacgagctggacttttccatcctcttcgattatgactatctgaac
cctatcgaagaagaaccgatcgcacataaggccatcagctcaccctccggactcgcatac
ccggatgatgtcctggactatggcctcaagccatgcaaccctctcgccagtctctctggc
gagccccctggccggttcggagagtcggatagtatagggttccagaactttctgagcccg
gccaagccagcaggggcttcgggcccgagccctcggatcgagatcactccatcccacgaa
ctgatgcaggcagggggggccctccgtgggagagatgccggcctgtcccccgagcagccg
gccctggctctggccggcatggccgccagcccgaggttcacactgcccgtgcccggcttc
gagggctaccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttc
atttctgacaccttctccccctacacctcgccctgcgtctcacccaataacgccgggccc
gacgacctgtgtccccagtttcaaaacatccctgctcattattcccccagaacctctcca
ataatgtcacctcgaaccagcctcgccgaggacagctgcctgggccgacactcgcccgtg
ccccgtccggcatcccgctcctcctcacccggtgccaagcggaggcattcgtgcgcagag
gccttggttgcccctctgcccgcagcctcaccccagcgctcccggagcccctcgccacag
ccctcgcctcacgtggcaccccaggacgacggcatccccgctgggtacccccccacggcc
ggctctgctgttctcatggatgccctcaacagcctggccaccgactcgccctgcgggatc
ccctctaagatatggaagaccagtcctgatccaactcccgtgtccactgctccatccaag
gcaggcctggcccgccacatctaccctgctgtggagttcctggggccgtgtgagcaggag
gagaggaggaattccgctccagagtccatcctgctggtaccacccacctggcccaagcaa
ttggtgccggccattcccatctgcagcatccccgtgactgcatccctcccaccactagag
tggccactctccaaccagtcgggctcctatgagcttcggattgaggtccagcccaagccc
catcaccgagcccactatgagacagagggcagccgtggcgctgtcaaagccccaacagga
ggacaccctgtggtgcagctccacggctacatggagaacaagcctctggggcttcagatc
ttcatcgggacggctgatgaacggatccttaagccacacgccttctaccaagtacacagg
atcactgggaaaacagtgacaaccactagctatgagaagattgtgggcaacaccaaggtc
ctggagatccccctggagccaaagaacaacatgcgggccaccatcgactgcgcaggcatc
ctgaagctccgaaacgctgacatcgagctgcggaagggtgagacagacataggcagaaag
aacacgcgtgtgcgccttgtgttccgtgtgcacatcccggagcccagtggacgcatcgtc
tccctgcaggctgcatccaaccccatcgagtgctctcagcgctctgcccacgagctgccc
atggtggagagacaagacatggacagctgcctggtctacggcggccagcagatgatcctc
acgggccagaacttcacagctgagtccaaggttgtgttcatggagaagactacagatggg
cagcagatttgggagatggaagctacagtggataaagacaagagccagcctaacatgctt
tttgttgagatccccgagtatcggaacaagcacatccgggtgcccgtgaaagtgaacttc
tacgtcatcaacggaaagagaaaacgaagtcagccacagcactttacttaccacccagtc
cccgccatcaagacagagcccagcgatgagtatgaaccgtctttgatctgcagccccgcc
cacggaggcctggggagccagccatattacccacagcacccaatgctggccgagtccccc
tcctgtcttgtggccaccatggccccttgccaacagttccgctcagggctctcatcccct
gatgctcgctaccagcagcagagccccgcagccgccctctaccagaggagcaagagcctg
agtccaggcctgctgggctaccagcagccgtccctcttggcagcacccttgggtctggct
gatgcccaccgttctgtgctggtgcatgctggttcgcaggggcaggggcaggggcagggc
tccaccttgccacacacctcctcggccagccagcaggcctcacccgtgatccactactca
cccaccaaccagcagcttcgtggtgggggtcaccaggagttccagcatatcatgtactgt
gagaacttcggccccagctctgtcaggcctggcctgcctcccgtcaaccaaggtcagagg
ctgagcccagggtcctaccccacggtcatccaacaacagactgccccgagccaaagagct
gccaaaaacggacccccggtcagtgaccagaaggaagccctgcccagtggagtgacagtc
aaacaggagcagaacctggaccagacttacctggatgacgttaatgaaatcatcaggaag
gagttttcgggacctccctcccgaaatcagacctag

KEGG   Rattus norvegicus (rat): 361400
Entry
361400            CDS       T01003                                 

Gene name
Nfatc3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04625  C-type lectin receptor signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04921  Oxytocin signaling pathway
rno05135  Yersinia infection
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    361400 (Nfatc3)
   04310 Wnt signaling pathway
    361400 (Nfatc3)
   04022 cGMP-PKG signaling pathway
    361400 (Nfatc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    361400 (Nfatc3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    361400 (Nfatc3)
   04660 T cell receptor signaling pathway
    361400 (Nfatc3)
   04658 Th1 and Th2 cell differentiation
    361400 (Nfatc3)
   04659 Th17 cell differentiation
    361400 (Nfatc3)
   04662 B cell receptor signaling pathway
    361400 (Nfatc3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    361400 (Nfatc3)
  09158 Development and regeneration
   04360 Axon guidance
    361400 (Nfatc3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    361400 (Nfatc3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    361400 (Nfatc3)
   05170 Human immunodeficiency virus 1 infection
    361400 (Nfatc3)
   05161 Hepatitis B
    361400 (Nfatc3)
   05163 Human cytomegalovirus infection
    361400 (Nfatc3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    361400 (Nfatc3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    361400 (Nfatc3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    361400 (Nfatc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361400 (Nfatc3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    361400 (Nfatc3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 361400
NCBI-ProteinID: NP_001101917
RGD: 1308692
Ensembl: ENSRNOG00000054264
UniProt: D3ZU59
Position
19
AA seq 1068 aa
MTTANCGAHDELDFKLVFGEDGAPTPVSQVSRPADLEPDDCASIYIFNVDPPPSTLNSSL
GLPHHGLLQSHSSVLSPSFQLQGFKNYEGTDDISESKYSSLSGPKPFECPSIQITSISPN
CHQETDAHEDDLHVNDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSVSSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGPGHSLSPRQ
SPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLTAPVHTGSGLSPAPFPFQYCVETDIPLKTRKTSDDQAAILPGKLEVCS
DDQGSLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEAEGKIIREKCQGGH
IVLEVPPYHNPAVTSAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEQREDTDLSSVPSLP
VPHSAQTQRPSSDTGHPHDSALSAPRSLICPVQPAYASMITSTHLPQLQCRDEGAGKEQH
IIPSSVMHQPFQVTPTSPMGSSYQSIQTNMYNGPTCLPMNPASSQEFDPVLFQQDAALSN
LVNLGCQPLSPIPFHSSNSDATGHLLAHSPHSVQTPPHLQSMGYHCSSAGQRSLSSPVAA
QVTGQPSSHLQPITYCPSHPGSATAASPAASHALSSSPISGPPSPQLQSMPYQSPSSGTA
SSPSPVTRMHSGQHSTQAQSTGQGGLSVPSSLVCHSLCDPASFPPGGAAVSIKPEPEDQE
PNFATIGLQDITLDDDQFMSDLEHQPSGSTEKWPNHSEFSCPVPFWRI
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgactttaaactcgtcttcggcgag
gacggggcaccaacgccggtgtcccaggtctcgcggcctgcagatcttgaaccagatgat
tgtgcatccatttacatctttaatgtagacccgcctccatctactttaaattcatcactt
ggcttaccacatcatggactgctgcagtctcactcttctgttttgtcaccatcatttcag
ctccaaggtttcaaaaattatgaaggaactgatgatatttctgaatctaaatatagctca
ttaagtggtcctaaaccctttgaatgcccaagtattcaaattacatccatctctcctaac
tgtcatcaagaaacagatgctcatgaagatgacctacatgtaaatgacccagaaagggaa
tatttggaaaggccttctagagatcatctctatctcccacttgaaccgtcctaccgggaa
tcttcccttagtcctagtcctgccagcagcgtttcttctaggagttggttctcagatgca
tcttcttgtgagtctctctcacacatttatgacgatgtggactcagagttgaatgaagct
gctgcacgatttactcttggctcacctctgacttctccaggtggctctccaggaggttgc
cctggagaagagtcctggcatcaacagtatggacctggacattccttgtcacctaggcaa
tctccttgccactctcctagatccagtatcactgatgagaattggctgagccccagacca
gcctcaggaccctcatccaggcccacttctccttgtggtaaacgacggcactccagtgct
gaagtatgttatgctggctctctttcaccccatcactcacctgttccgtcccctggtcac
tcgcctagagggagtgtaactgaagatacctggctcactgctcctgtccacactggatca
ggcctcagccctgcaccgtttccatttcagtactgtgtagagactgacatccctttgaaa
acaaggaagacttctgacgatcaagctgccatactaccaggaaaattagaggtctgttca
gatgatcaagggagcttatccccatcccgggagacatcagtagatgatggccttggatct
cagtatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcacctttt
acctggagcaaaccaaagcctggccacactcctatatttcgcacatcttcattacctcca
ttagactggcctttaccaactcactttggacaatgtgaattgaaaatagaagtgcaacct
aaaactcaccatagagcccattatgaaactgaaggtagccgaggggcagtgaaagcctct
actggtggccatcctgttgtgaagctcctgggctatagtgaaaagccaataaatctacag
atgtttattggaacagccgatgatagatatttacgacctcacgcattttaccaggtgcat
cgcattactggaaagacagttgctactgcaagtcaagagataataatcgccagcacaaaa
gttctggaaatcccacttctacctgaaaataatatgtcagcaagtatcgactgtgcaggt
attttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcaga
aagaatactagagtccgacttgtatttcgtgtgcacatcccacagcccagtggaaaagtc
ctttctctacagatagcatctattcctgttgagtgctctcagcgatctgctcaagagctc
cctcacattgagaagtacagtatcaacagctgctctgtcaatggaggccacgaaatgatt
gtgactggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagat
ggaagacctcattgggaggctgaaggaaaaataatcagagaaaaatgtcaagggggtcat
attgtccttgaagttcctccctatcataacccagcagttacatctgctgtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacaaagagaagatactgatttgtcttcagttccatccttgcct
gtgcctcattctgcccagacccagaggccttcctcagatacagggcacccccatgacagt
gcattgtctgcaccaagaagcttgatttgtccagtgcagccagcatatgcatctatgata
acctccacccatttgccacagttgcaatgtagggatgagggtgctggcaaagaacagcac
ataataccatcttcggtcatgcaccagccttttcaagttacaccaacatctcctatgggg
tcttcctatcagtctatacaaactaatatgtataatggtccaacttgtcttcctatgaat
cctgcctctagtcaagaatttgatccagttttgtttcagcaggatgcagctctttctaat
ttagtaaatcttggctgtcaaccactgtcaccaataccatttcattcttcaaattcagat
gcaacaggacatcttttagctcattcacctcattctgtgcaaaccccacctcatctgcag
tcaatgggataccattgttcaagtgcaggacaaagatctctttcttctccagtagcagcc
caggtcacaggtcagccttcttcccatttacagcctatcacatattgtccttcacatcca
gggtctgctacagcagcttccccagcagcctctcatgctctttctagttcaccgatttct
gggccaccgtcccctcagctgcagtctatgccttaccaatctcctagctcaggaactgcc
tcatcaccatctccagttaccagaatgcattctggacagcactcaactcaagcacaaagt
acagggcaaggaggtctttctgtaccttcatccttagtttgtcacagtttgtgtgaccca
gcatcgtttccacctggtggtgcagctgtgagcattaaacctgaacctgaagatcaagaa
cctaactttgcaaccattggtctacaggatatcactttagatgatgaccagtttatgtct
gacttggaacaccagccatcaggttcaacagagaaatggcctaatcacagtgagttctca
tgtccagttcctttctggcgaatctag

DBGET integrated database retrieval system