KEGG   Rattus norvegicus (rat): 100361854Help
Entry
100361854         CDS       T01003                                 

Definition
(RefSeq) ribosomal protein S26-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S26e Fer4_7
Motif
Other DBs
NCBI-GeneID: 100361854
NCBI-ProteinID: XP_002730256
RGD: 2319323
Ensembl: ENSRNOG00000029512
UniProt: D3Z8D7
Position
Xq34
AA seq 115 aa AA seqDB search
MTKKRRNNGRAKKGRGQVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD
AYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaaaggagaaacaacggtcgtgccaaaaagggccgcggccaggtgcaacca
attcgctgcacgaactgcgcccggtgcgtgcccaaggataaggccattaagaagtttgtc
attcggaacattgtagaagccgctgcagtcagggacatatctgaagcaagcgtcttcgac
gcttacgtgcttcccaagctctatgtcaagctgcactactgcgtgagctgtgccattcat
agcaaggttgtcaggaatcgatctcgtgaggcccggaaggaccgaacacccccaccacga
ttcagacctgctggcgctgcaccacgacctccaccaaagcccatgtaa

DBGET integrated database retrieval system