KEGG   Rattus norvegicus (rat): 100361907
Entry
100361907         CDS       T01003                                 

Definition
(RefSeq) complement factor H-related protein B
  KO
K23815  complement factor H-related protein 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100361907
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100361907
NCBI-ProteinID: XP_003752693
RGD: 2319172
UniProt: Q5FVP9
Position
13q13
AA seq 393 aa
MGFCNLLLLTTVFLTLWFTTSKGEGIACKPPYIPNGIYSPHKINYTIDDEIKYECKNGFY
PATKGTVAKCTSTGWIPLPRCSLKPCDFPQFKHGRLYYEESRRPYFPVPIGKEYSYYCDN
GFTTPSQSYWDYLRCTVNGWEPEVPCLRQCIFHYVENGESSYWQRRYIEGQSAKVQCYSG
YSLPNGQDTMICTENGWSPPPKCVRIKSCDMPVFENAVIKNNSTWFKLNDKIDYECHDGY
ENKYKQTKGSITCNDDGWSDKPSCYDSTKICGPPPPIDNGDTTSFPLQRYIPSSSVEYQC
QSLYQLQGNKTIICINGEWSDPPKCLHPCIISKEIMEKHNITFRWEEKQKRYYQSGETQE
FKCKNGHHLATTQPLITICINGQINYPTCTKSH
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggggttctgtaacctgttgctcttaaccactgtcttcctaaccttatggttcactact
tccaaaggtgaaggaatagcatgcaaacccccgtatattccaaatggaatctactcacct
cataagattaactacacaatcgatgatgaaataaaatatgaatgtaaaaatggcttctac
cctgcaacaaagggaactgttgcaaagtgtacaagtactggatggatccctcttccaaga
tgtagtttgaagccttgtgattttccacaattcaaacatggacgtctgtattatgaagaa
agccggagaccctacttcccagtacctataggaaaggagtacagctattactgtgacaac
gggtttacaacgccttcacagtcgtactgggactaccttcgttgcacagtaaatgggtgg
gagcccgaagttccatgcctcaggcaatgtattttccattatgtggaaaatggagaatct
tcatactggcaaagaagatatatagagggtcagtctgcaaaagtccagtgttacagtggc
tatagtcttccaaatggtcaagatacaatgatatgtacagaaaatggctggtcccctcct
cccaaatgcgtccgtatcaagtcatgtgatatgcctgtgtttgagaatgctgtaattaag
aataatagcacatggtttaaactcaacgacaaaatagactatgaatgccatgatggatat
gaaaacaaatataaacaaaccaaaggctccataacttgtaatgatgatggatggtctgat
aagccctcatgttatgattcaacaaagatctgtgggcctcctccacctattgacaatgga
gacaccacatccttcccactacaacgatacataccatcatcatcagttgaatatcagtgc
cagtctttataccaactgcagggcaacaagacaataatatgtataaatggagagtggtct
gatccaccaaaatgtttacatccctgtataatatcaaaagaaattatggaaaaacataac
ataactttcagatgggaagaaaaacaaaagcgctattaccaatcaggggagacgcaagaa
tttaagtgtaaaaacggacatcatctggcaacaactcaaccgttgattacaatatgcatt
aatggtcaaatcaattatcccacttgtacaaaatcacactaa

DBGET integrated database retrieval system