KEGG   Rattus norvegicus (rat): 100361907
Entry
100361907         CDS       T01003                                 

Definition
(RefSeq) complement factor H-related protein 2-like isoform X3
  KO
K23815  complement factor H-related protein 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100361907
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100361907
NCBI-ProteinID: XP_008767803
RGD: 2319172
Position
13
AA seq 334 aa
MGFCNLLLLTTVFLTLWFTTSKGEGIACKPPYIPNGIYSPHKINYTIDDEIKYECKNGFY
PATKGTVAKCTSTGWIPLPRCSLKPCDFPQFKHGRLYYEESRRPYFPVPIGKEYSYYCDN
GFTTPSQSYWDYLRCTVNGWEPEVPCLRQCIFHYVENGESSYWQRRYIEGQSAKVQCYSG
YSLPNGQDTMICTENGWSPPPKCVRINSTKICGPPPPIDNGDTTSFPLQRYIPSSSVEYQ
CQSLYQLQGNKTIICINGEWSDPPKCLHPCIISKEIMEKHNITFRWEEKQKRYYQSGETQ
EFKCKNGHHLATTQPLITICINGQINYPTCTKSH
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggggttctgtaacctgttgctcttaaccactgtcttcctaaccttatggttcactact
tccaaaggtgaaggaatagcatgcaaacccccgtatattccaaatggaatctactcacct
cataagattaactacacaatcgatgatgaaataaaatatgaatgtaaaaatggcttctac
cctgcaacaaagggaactgttgcaaagtgtacaagtactggatggatccctcttccaaga
tgtagtttgaagccttgtgattttccacaattcaaacatggacgtctgtattatgaagaa
agccggagaccctacttcccagtacctataggaaaggagtacagctattactgtgacaac
gggtttacaacgccttcacagtcgtactgggactaccttcgttgcacagtaaatgggtgg
gagcccgaagttccatgcctcaggcaatgtattttccattatgtggaaaatggagaatct
tcatactggcaaagaagatatatagagggtcagtctgcaaaagtccagtgttacagtggc
tatagtcttccaaatggtcaagatacaatgatatgtacagaaaatggctggtcccctcct
cccaaatgcgtccgtatcaattcaacaaagatctgtgggcctcctccacctattgacaat
ggagacaccacatccttcccactacaacgatacataccatcatcatcagttgaatatcag
tgccagtctttataccaactgcagggcaacaagacaataatatgtataaatggagagtgg
tctgatccaccaaaatgtttacatccctgtataatatcaaaagaaattatggaaaaacat
aacataactttcagatgggaagaaaaacaaaagcgctattaccaatcaggggagacgcaa
gaatttaagtgtaaaaacggacatcatctggcaacaactcaaccgttgattacaatatgc
attaatggtcaaatcaattatcccacttgtacaaaatcacactaa

KEGG   Rattus norvegicus (rat): 289057
Entry
289057            CDS       T01003                                 

Gene name
Cfhr1
Definition
(RefSeq) complement factor H-related protein 1 precursor
  KO
K23815  complement factor H-related protein 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    289057 (Cfhr1)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 289057
NCBI-ProteinID: NP_001037692
RGD: 1310510
Ensembl: ENSRNOG00000042901
UniProt: Q5I0M3
Position
13
AA seq 274 aa
MGFCRLLFLVNVLLTSWFSSAKGEGIHCDFPKIRHGIVYDEKKYEPFSPVPGGKILYYSC
EYNFASPSSSFWNPIICTEAGWSPVPKCLRICFFPSVENGHSTSSGQTHKEGDIVQIVCN
QGYSLQNNQSTITCGEEGWSIPPKCISPNSAGKCGPPPSIDNGDITSLSLPEYAPLSSVE
YQCQNYFLLKGNKIITCRNGKWSDPPTCLHACVIPEDILEKHNIVLRWRENGRIYSQSGE
NIEFMCKPGYRKLRGSPPFRSKCIDGHINYPTCL
NT seq 825 nt   +upstreamnt  +downstreamnt
atggggttctgtcgcctgttgttcttagtcaatgtcctcctaacctcatggttctcttct
gccaaaggggaagggatccattgtgattttccaaaaataagacatggaatagtgtatgat
gaaaagaaatatgagccattttcaccagttcctggtgggaagattttatactactcctgt
gaatataattttgcgtctccttcaagttccttctggaatcccataatttgcacagaagca
ggatggtcaccagttccaaagtgtctaaggatctgcttctttccttctgtggaaaacggt
cattctacatcttcaggtcaaacacacaaagaaggtgatattgtacaaattgtttgcaat
caaggctacagccttcagaataatcagagcaccatcacctgtggtgaagagggctggtcc
attccgccaaaatgcatttcccccaattcagcagggaaatgtgggcctcctccatctatt
gacaatggagacatcacctccttgtcattaccagaatatgcaccattatcatcagttgaa
tatcagtgccagaactactttttacttaagggaaataagataataacatgcagaaatgga
aagtggtctgacccaccaacctgcttacatgcatgtgtaataccagaagatattctggaa
aaacataacatagttctgagatggagagaaaatggaaggatttattcccaatcaggggag
aatattgaattcatgtgtaaacctggatatagaaaattaagaggatcacctccatttcgt
tcaaaatgcattgatggtcacatcaattatcccacttgtctgtaa

DBGET integrated database retrieval system