KEGG   Rattus norvegicus (rat): 100361909Help
Entry
100361909         CDS       T01003                                 

Gene name
Ear1, Ear3, Raf4
Definition
(RefSeq) eosinophil-associated, ribonuclease A family, member 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 100361909
NCBI-ProteinID: XP_002725102
RGD: 2324564
Ensembl: ENSRNOG00000025515
UniProt: E9PU07
Position
15p14
AA seq 151 aa AA seqDB search
MGLKLLESRLCLLLLLGLVTCQRPTPSQWFAIQHIYNSSYPQCNAAMLRVNSYTGRCKGI
NTFLHASFANVVGVCGNPHTTCKDRISTNCHNSSSQVSITFCNLTTPARIYTQCRYQTTG
SLKFYTVACNPRTPRDSPMYPVVPVHLDRIF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgaagctgctcgagtccagactttgtctccttctgcttctgggacttgtcaca
tgccagcgaccaaccccttcccagtggtttgccatccagcacatctataatagctcctac
ccccaatgtaatgctgccatgctgcgtgtcaacagttatacaggaagatgtaagggcata
aatactttccttcatgcaagttttgctaatgttgttggtgtgtgtggcaatccacataca
acctgtaaagacagaatcagtacgaattgtcataacagttcatctcaggtatctataact
ttctgtaacctcacaactccggcaaggatttatacccaatgcagataccaaactacagga
tcgttgaagttctacacagttgcctgtaaccccagaactccacgggacagtcccatgtat
ccagtggttccggttcacttggataggatattttag

DBGET integrated database retrieval system