KEGG   Rattus norvegicus (rat): 100362023
Entry
100362023         CDS       T01003                                 

Definition
(RefSeq) CDC42 small effector 2-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: PBD
Other DBs
NCBI-GeneID: 100362023
NCBI-ProteinID: XP_002725615
RGD: 2318957
UniProt: V9GZ87
Position
1q21
AA seq 84 aa
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM
QSKGGYGGGMPANVQMQLVDTKAG
NT seq 255 nt   +upstreamnt  +downstreamnt
atgagtgaattctggctgtgcttcaactgctgtattgcagagcagcctcagcctaagagg
cgacgacggattgaccgaagtatgattggggaaccaaccaactttgtgcacacagctcac
gtaggatccggagacctatttagtgggatgaactcggtcagctccattcagaaccagatg
cagtccaagggaggttatggaggaggaatgcctgccaatgtgcagatgcagcttgtggac
acaaaggcaggatag

DBGET integrated database retrieval system