KEGG   Rattus norvegicus (rat): 100362124Help
Entry
100362124         CDS       T01003                                 

Gene name
Ift140
Definition
(RefSeq) intraflagellar transport 140
  KO
K19672  intraflagellar transport protein 140
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100362124 (Ift140)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex A
    100362124 (Ift140)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 Clathrin Coatomer_WDAD RNase_HII Exo84_C tRNA_int_end_N2 TPR_2
Motif
Other DBs
NCBI-GeneID: 100362124
NCBI-ProteinID: XP_002727774
RGD: 2318759
Ensembl: ENSRNOG00000016545
UniProt: F1LY69
Position
10q12
AA seq 1463 aa AA seqDB search
MALYFDHRIKAPDASSSPSHITWHPTHPFLAVASVSPSSGGNVDIYLEQGEPVPDTHIER
SFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVS
GDKLGVLLLWRLDQRGRVQGTPLLKHEYGKPLTHCIFRLPPPGEDLVQLAKAAVSGDEKA
LDMFNWRKSSFGSFLKTGSQEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIE
KREALVVVTQNLLLSLYVVNPEGEAEEVMKVKLSGKTGRRADITLIEGSLLVTAIGEPVL
RFWDLERGENYILSLQEKFGFEKGENINSVCYCKAKGLLAAGTHKGRVAMWKKVPVSPSG
RGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVSTSDSVSILSEQAMSSHFHQQVAAV
QISPSLVNVSFLSTGSTHSLRTDMHISGVFATKDAVAVWNGKQVAIFEPSGSTLRNAGTF
LCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDL
AHFKSFDLSRREAKVHCSCKNLAQMIPDVGSITSLRCNANGNKISILLSKVDNSPDSKIY
VYDVEMDTVNVFNFKTGHIGQIQTLPFNEPPTNEAHFFMNESLASYVPVNHFWDQSEPRL
FVCEALQEAPGAQPQAIDKQPHMEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQS
LLGLEVPHYYFTKKPGEADKEDKMDSGHYHIPQMVAKKPLRDFVGLEDCDKPTRDAMLNF
SFFVTIGDMDEAFKSIKLIKSETVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREA
EREPELEARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVH
LRTTYYNYAKHLEASADCGLALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWR
WWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQ
YESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGE
QMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQF
EKAVELLLAAKKYHEALQLCLEQNMTITEEMAEKMTVSKDSKDLSEESRRELLEQIANCC
MRQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDW
RKEPEIMKNIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAKA
KNPLDQETKLAQLQSKMTLVKRFIQARRTYTEDPKESVRQCELLLEEPDLDSTIRVGDIY
GFLVEHHVQMEEYQMAYKYLEEMRKRLPSANMSYYVDQRTVDTVHQGLGLPPSRIMPERV
RHNSMEDHKEVYEEVIEEVDNDP
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtattttgaccaccgaatcaaagctccagatgcatccagctctccctctcac
atcacctggcaccccacccacccattcctggcagtggcatctgtaagcccatcttctgga
ggcaacgtagacatctaccttgaacaaggtgagcccgtgcctgacacccacattgagagg
tccttccaggccacttcactatgctggcacccaacaaggcttatcctggctattggctgg
gaaactggagaagtaataatgtttaataagcaggacaaggagcagcacacggtgcccctg
ccacatacgactgacattgccatcctcagttggagtaccagcgggagctgcctggtatct
ggagacaagctcggggtcctgctcttgtggagattggaccagcgaggccgagtacagggg
acaccactcctgaaacacgaatacgggaaaccgctcacccattgcatcttccggctcccc
cctcctggggaggatctggttcagttggcaaaggcagcagtaagtggggatgagaaagcc
ctggacatgtttaactggagaaaaagcagctttggaagtttcctgaagacggggtctcaa
gaggggctgtctttctttgtcagtctcatggatgggacagtgcactatgtggatgaaaag
ggcaagactgctcaggtggcatccacggacagctctatccagaccctgttctacattgag
aagagagaggcactggttgtggtcacacagaaccttctcctgtctctgtatgtggtgaat
cctgagggggaagctgaagaagtcatgaaggtaaagttgagtgggaagacaggccgccgg
gcagatatcactctgatagagggcagtcttcttgtgacagctattggggaacctgtgctc
aggttctgggacttagaacggggagagaattacatactgagtctacaggagaagtttggc
tttgaaaagggagagaatataaactctgtgtgttactgtaaagccaaaggtctcctggca
gctggtacccataaaggacgagtagccatgtggaagaaagtgccagtgtccccaagtggc
cgtggggcggagggcaaggatatgtgggcccttcagacacctactgagcttgaaggaaac
atcacacagataaagtggggctccaggaagaacctgctggcggtgagcacctctgactcc
gtgtccatcctcagtgagcaagccatgtcgtcacacttccaccagcaagtggctgccgtg
cagatctccccgagcctagtcaacgtgtctttcctgtccacggggagcacgcacagcctg
cgcaccgacatgcacatcagtggagtgtttgccaccaaggatgctgttgctgtctggaat
ggaaaacaggtggcgatctttgaaccttcagggtccaccttacgcaatgcagggacattc
ctgtgtgaaacatcggtgctagccatgcacgaggaaagcatttacactgtagagccaaac
cgactccaagtccgcacctggcagggcactgtcaaacaacttctgctgttctctgagacc
gaggggagcccctgcttcctagatgtctgtgggactttcctggttgcagggacagattta
gctcactttaaaagttttgatctttccagaagggaagcaaaagtgcactgcagctgcaag
aacctggcccagatgatccccgacgtggggagcatcacttcactgagatgcaatgccaat
gggaacaagatcagtatcctccttagcaaggttgacaacagtcctgattccaaaatctac
gtctatgacgttgaaatggacacagtgaatgtcttcaacttcaagactggacacattgga
cagatacagactctgccctttaatgagcctccgaccaatgaggcccacttctttatgaat
gagagcctagcaagttacgttcctgtgaaccatttctgggatcagagtgaacccaggctc
tttgtgtgcgaggccttgcaggaggcacctggagcccagccacaggctatagacaagcag
ccccacatggaggaaggcacgtgccacaaggaagaagtattaattctctcattcttcgct
tctgaagagcatggcttcctgcttcatgacagcttcccccggccttcaacctaccagagc
cttctgggcctggaagtgcctcactattacttcacaaaaaagcctggagaagcagacaaa
gaagacaagatggattctgggcactaccacatccctcagatggtagccaagaagccccta
cgagactttgtggggctggaggactgtgacaagcctactcgggatgccatgctcaacttc
agcttctttgtcaccattggagacatggatgaagctttcaaatctatcaaactcatcaag
agtgagaccgtctgggagaacatggcacgcatgtgtgtgaagactcagaggctggatgtt
gccaaggtgtgcctagggaacatgggccatgcccggggggcccgagcactgcgggaagct
gagcgggaaccagaactagaagccagagtggccatgttggccatacagctgggcatgctg
gaggaggctgaacaactgtataagaagtgcaaacgctacgacctcctaaacaagttctac
caggcctcagaccagtggcagaaagctgtggaggtagcagagctccatgaccgagtccac
ctgcgcaccacctactacaactatgccaagcacctggaggccagcgccgactgcggcctg
gccctcagctactatgagaagtcagacacacaccgttttgaggtacctaggatgctctca
gaagacctgcagtcactggagctgtacatcaataggatgaaggacaagaccctgtggaga
tggtgggcccagtacctggagagccaggcagagatggacaccgcgttgcgctactacgag
ctggcccaggactacttctccctggtccgtattcactgcttccagggcaacattcagaag
gctgctgaaatagccaacgagactggagactgggctgcatcctaccaccttgcccggcag
tacgagagccaggatgaggtaaaacaggcagtgcacttctacacacgggcacaggctttc
aacaacgccatccgcctgtgcaaggagaatggcttagatgaccaactcatgaacttggcc
ctcttgagctcccccgaggacatgattgaggcagcccggtattacgaggagaagggcgag
cagatggacagggcagtcatgctgtatcacaaggctggacacttctccaaggccctggag
ctggccttcaccacccagcagtttgcagccctacaactcatagcagaggacctggatgag
aagtcagatcctgctctcctggcccgctgctcagacttctgcattgagcacagacagttt
gaaaaggccgtggagcttctgctggctgccaagaagtaccacgaggctctgcagctgtgc
ctagagcagaacatgaccatcactgaggagatggccgagaagatgactgtgtccaaggac
tcgaaggacctgtccgaggagtcacggcgtgagctgctagaacagattgcaaactgctgt
atgcgccagggcaactatcacctggctaccaagaagtacacacaggctgggaacaagctg
aaggccatgagagccctgctcaaatctggagacacagagaaaattgtgttctttgcgggt
gtctcaagacagaaggaaatctacatcatggctgccaattacctacagtccttggactgg
cggaaggagccagagattatgaagaatatcattagcttctacacaaaagggcgggccttg
gacctcctggctggcttctatgatgcctgcgcccaggtggagattgacgaataccagaac
tatgacaaggcccatggagcactgactgaggcctataagtgcctgtccaaagccaaggcc
aagaaccctctggaccaggagaccaagctagcccagctacagagcaagatgacactagtg
aagaggttcatccaggcccgaaggacatacacagaggaccccaaagaatccgtcagacaa
tgcgagctgctcctagaagagccagacctagacagcaccattcgtgtcggggacatctat
ggcttcctggtggagcaccatgtgcagatggaggaataccagatggcctataagtatctt
gaggagatgaggaaaagacttccttctgccaacatgtcatactatgtggaccagcgcact
gtggacactgtgcaccagggtctgggcctccctccatctcgcatcatgcctgagcgggtc
cgccacaacagcatggaggaccacaaggaggtgtacgaggaggtgatagaagaggtggac
aatgacccctga

DBGET integrated database retrieval system