KEGG   Rattus norvegicus (rat): 100362321Help
Entry
100362321         CDS       T01003                                 

Gene name
Smim19
Definition
(RefSeq) small integral membrane protein 19
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0697
Motif
Other DBs
NCBI-GeneID: 100362321
NCBI-ProteinID: XP_002728462
RGD: 2318364
Ensembl: ENSRNOG00000024930
UniProt: F1LVG4
Position
16q12.5
AA seq 107 aa AA seqDB search
MAGSYGMMADDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRKIMRIFSVPPAG
EMLSEPSFYDTMNRIRLRQQVEAHPVSRKYEYQQPQSQADSVQLSLE
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggccggaagttatggtatgatggctgacgacggttctattgactacacagtccatgaa
gcctggaacgaagccaccaatgtttacttgatagttatccttgttagctttggtctcttc
atgtatgccaagaggaataagaggaagattatgagaatattcagcgtgcctcctgcagga
gagatgctgtcagaacccagcttttatgacacaatgaacagaatccgcttaagacagcaa
gtggaggcgcatcccgtttcaagaaagtacgagtatcaacagccacaaagccaggctgac
agcgtgcagctctcgttggagtga

DBGET integrated database retrieval system