KEGG   Rattus norvegicus (rat): 100362331
Entry
100362331         CDS       T01003                                 

Gene name
Ndufa4l2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100362331 (Ndufa4l2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100362331 (Ndufa4l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100362331 (Ndufa4l2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100362331 (Ndufa4l2)
   05012 Parkinson disease
    100362331 (Ndufa4l2)
   05014 Amyotrophic lateral sclerosis
    100362331 (Ndufa4l2)
   05016 Huntington disease
    100362331 (Ndufa4l2)
   05020 Prion disease
    100362331 (Ndufa4l2)
   05022 Pathways of neurodegeneration - multiple diseases
    100362331 (Ndufa4l2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100362331 (Ndufa4l2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100362331 (Ndufa4l2)
SSDB
Motif
Pfam: B12D
Other DBs
NCBI-GeneID: 100362331
NCBI-ProteinID: NP_001258201
RGD: 2324558
Ensembl: ENSRNOG00000031851
Position
7
AA seq 87 aa
MAGTSLGARFYRQIKRHPGLIPMIGFICLGMGSAGLYLLRLALRSPDVCWDRKNNPEPWN
RMSPNDQYKFLAVSTDYKKLKKDRPDF
NT seq 264 nt   +upstreamnt  +downstreamnt
atggcaggaaccagtctaggggcccgcttctaccggcagataaaaagacaccctgggctc
atcccaatgatcggcttcatctgcttgggcatgggcagtgccggactctacttgctgcgg
cttgcccttcgcagccctgatgtctgctgggacagaaagaacaacccagagccctggaac
cgcatgagtcccaatgaccagtacaagttccttgctgtttccaccgactacaagaagctg
aagaaggaccggcctgacttctaa

KEGG   Rattus norvegicus (rat): 100363268
Entry
100363268         CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100363268
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100363268
  09159 Environmental adaptation
   04714 Thermogenesis
    100363268
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100363268
   05012 Parkinson disease
    100363268
   05014 Amyotrophic lateral sclerosis
    100363268
   05016 Huntington disease
    100363268
   05020 Prion disease
    100363268
   05022 Pathways of neurodegeneration - multiple diseases
    100363268
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100363268
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100363268
SSDB
Motif
Pfam: Ndufs5 Cmc1
Other DBs
NCBI-GeneID: 100363268
NCBI-ProteinID: XP_002729126
RGD: 2323372
Ensembl: ENSRNOG00000029339
UniProt: B5DEL8
Position
2
AA seq 106 aa
MPFLDVQKRLGISLDRHFIFLSAEQPYKNAARCHAFEKEWIECAHGIGATRAKKECKIEY
EDFEECFLRFKTIRRMHEIKKQREKLMKEGKYTPPPHHLGKEEPRP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcctttccttgatgtgcagaaaaggctgggcattagcctagatcgacactttatattc
ctaagtgctgagcagccttacaagaatgccgctcgatgccacgcgtttgaaaaggagtgg
atagaatgcgcacatgggatcggtgctacccgggctaaaaaagagtgcaagatagagtat
gaagactttgaagaatgctttcttcggttcaaaacgataaggcggatgcatgaaatcaag
aaacagcgggagaagctgatgaaagaggggaagtacacccctccgcctcaccatttgggc
aaggaggagcccaggccctga

KEGG   Rattus norvegicus (rat): 100911483
Entry
100911483         CDS       T01003                                 

Gene name
Ndufa13
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100911483 (Ndufa13)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100911483 (Ndufa13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100911483 (Ndufa13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100911483 (Ndufa13)
   05012 Parkinson disease
    100911483 (Ndufa13)
   05014 Amyotrophic lateral sclerosis
    100911483 (Ndufa13)
   05016 Huntington disease
    100911483 (Ndufa13)
   05020 Prion disease
    100911483 (Ndufa13)
   05022 Pathways of neurodegeneration - multiple diseases
    100911483 (Ndufa13)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100911483 (Ndufa13)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100911483 (Ndufa13)
SSDB
Motif
Pfam: GRIM-19 Planc_extracel
Other DBs
NCBI-GeneID: 100911483
NCBI-ProteinID: NP_001264151
RGD: 6492821
Ensembl: ENSRNOG00000020602
UniProt: D3ZE15
Position
16
AA seq 144 aa
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFALGIGALIFGYWRIMRWNRERRRL
LIEDLEARIALMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESMFHTTRWVPPL
IGELYGLRTKEEMENANFGFTGYT
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcggcgtcgaaggtgaagcaggacatgcccccaccagggggctacggccccatcgac
tacaagcggaacctgccccgccggggactgtcgggatacagcatgtttgctttgggcatc
ggggccttgatctttggctactggagaataatgaggtggaaccgggagcgtaggcgcctg
ctgatcgaggacttggaggccaggatcgccctcatgccactcctccaggcagagaaggac
cgcaggaccctgcagattcttcgggagaacctggaggaggaggctatcatcatgaaagat
gtgcccaactggaaggtgggggagtctatgttccataccacacgatgggtgccacccctc
atcggcgagctttatgggttacgcaccaaggaggagatggagaacgccaacttcggcttc
accgggtacacttag

KEGG   Rattus norvegicus (rat): 25488
Entry
25488             CDS       T01003                                 

Gene name
Ndufa5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    25488 (Ndufa5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    25488 (Ndufa5)
  09159 Environmental adaptation
   04714 Thermogenesis
    25488 (Ndufa5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25488 (Ndufa5)
   05012 Parkinson disease
    25488 (Ndufa5)
   05014 Amyotrophic lateral sclerosis
    25488 (Ndufa5)
   05016 Huntington disease
    25488 (Ndufa5)
   05020 Prion disease
    25488 (Ndufa5)
   05022 Pathways of neurodegeneration - multiple diseases
    25488 (Ndufa5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25488 (Ndufa5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25488 (Ndufa5)
SSDB
Motif
Pfam: ETC_C1_NDUFA5 NEL
Other DBs
NCBI-GeneID: 25488
NCBI-ProteinID: NP_037117
RGD: 3155
Ensembl: ENSRNOG00000005698
UniProt: Q63362
Position
4
AA seq 116 aa
MAGLVKKTTGLVGLAVCDTPHERLTILYTKILDLLKHFPKHAAYRKYTEQITSEKLELVK
LEPDVKKLENLLQGGEVEEVILQAEKELSLARKMLQWKPWEPLVEEPPANQWKWPI
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcgggcttggtgaagaagactactggcctggtgggattggccgtttgcgacactcca
cacgagaggctaacaatattgtatacaaagattcttgatcttctgaagcactttcctaaa
catgcagcctacagaaagtacacagaacagatcaccagtgagaagctggagttggtcaaa
ttggaaccagatgttaaaaaattagaaaacttgcttcagggtggtgaagtagaagaggtg
attcttcaggctgaaaaagaactaagtctggcaagaaaaatgttgcagtggaagccctgg
gagccactggtggaggagccccctgctaaccagtggaagtggccaatataa

KEGG   Rattus norvegicus (rat): 26193
Entry
26193             CDS       T01003                                 

Gene name
ND1
Definition
(RefSeq) NADH dehydrogenase subunit 1
  KO
K03878  NADH-ubiquinone oxidoreductase chain 1 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26193 (ND1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26193 (ND1)
  09159 Environmental adaptation
   04714 Thermogenesis
    26193 (ND1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26193 (ND1)
   05012 Parkinson disease
    26193 (ND1)
   05014 Amyotrophic lateral sclerosis
    26193 (ND1)
   05016 Huntington disease
    26193 (ND1)
   05020 Prion disease
    26193 (ND1)
   05022 Pathways of neurodegeneration - multiple diseases
    26193 (ND1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26193 (ND1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26193 (ND1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26193 (ND1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26193 (ND1)
SSDB
Motif
Pfam: NADHdh DUF3262 DUF485
Other DBs
NCBI-GeneID: 26193
NCBI-ProteinID: YP_665629
RGD: 620555
UniProt: P03889 Q8HID1
Position
MT
AA seq 318 aa
MYFINILTLLIPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEP
MRPLTTSMSLFIIAPTLSLTLALSLWIPLPMPHPLINLNLGMLFILATSSLSVYSILWSG
WASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMSGSFSLQMLITTQEHIWLLIPAWP
MAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTSI
VFLGPLYHINYPELYSTSFMTETLLLSTTFLWIRASYPRFRYDQLMHLLWKNFLPLTLAF
CMWYISLPIFLAGIPPYT
NT seq 955 nt   +upstreamnt  +downstreamnt
gtgtactttattaatatcctaacactcctaatcccaatcttaattgccatggccttcctc
accctagtagaacggaaaatcctaggctacatacaactacgcaaaggccccaacatcgta
ggcccatatggtattctacaaccatttgcagatgccataaaactattcataaaagaaccc
atacgccccctaaccacctcaatatcactatttattatcgccccaaccctctcccttaca
ctagctctaagcctatgaatccccttaccaatacctcacccccttatcaacctcaaccta
ggcatactatttattctagccacatcaagtctttcagtctactccattctatgatcagga
tgagcatcaaattcaaaatactccctattcggagccctacgagccgttgcccaaaccatc
tcttacgaagtcacaatagccattatcctcttatccgtcctcctaataagcggctccttc
tccctacaaatacttatcactacacaagaacatatctgactattaatccccgcctgacca
atagccataatatgatacatttcaaccctagcagaaacaaatcgagctcccttcgactta
acagaaggagaatcagaattagtctcaggctttaacgtcgaatacgccgcaggaccattc
gccctattcttcatagccgagtacaccaatattatcctaataaacgccctaacatcaatt
gtattcctaggccccttatatcacatcaattaccctgaattatactcaaccagcttcata
acagaaacactacttctatccacaactttcctatgaatccgagcatcctacccccgtttt
cgatatgaccaactaatgcacctcctatgaaaaaatttcctcccactaacactagcattc
tgcatatgatacatttccctgccaattttcctagcaggaattccaccctacacat

KEGG   Rattus norvegicus (rat): 26194
Entry
26194             CDS       T01003                                 

Gene name
ND2
Definition
(RefSeq) NADH dehydrogenase subunit 2
  KO
K03879  NADH-ubiquinone oxidoreductase chain 2 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26194 (ND2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26194 (ND2)
  09159 Environmental adaptation
   04714 Thermogenesis
    26194 (ND2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26194 (ND2)
   05012 Parkinson disease
    26194 (ND2)
   05014 Amyotrophic lateral sclerosis
    26194 (ND2)
   05016 Huntington disease
    26194 (ND2)
   05020 Prion disease
    26194 (ND2)
   05022 Pathways of neurodegeneration - multiple diseases
    26194 (ND2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26194 (ND2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26194 (ND2)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26194 (ND2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26194 (ND2)
SSDB
Motif
Pfam: Proton_antipo_M NADH_dehy_S2_C
Other DBs
NCBI-GeneID: 26194
NCBI-ProteinID: YP_665630
RGD: 620556
UniProt: P11662 Q8HID0
Position
MT
AA seq 346 aa
MNPITLIIIYFTILMGPVITMSSSNLLLMWVGLEMSLLAIIPLLANKKSPRSTEAATKYF
LTQATASMIILLVIILNYKQSGMWTLQQQTNNMLLNMMLISLAMKLGLAPFHYWLPEVTQ
GIPLHIGLILLTWQKIAPLSILYQFYQLLNPTITTILAISSVFVGAWGGLNQTQTRKIMA
YSSIAHMGWMTAILPYNPNLTLLNLTIYILLTVPMFITLMTNSATTINTLSLAWNKTPMI
LTMTSIILLSLGGLPPLTGFLPKWAIISELLKNNCSTLSTLMAIMALLSLFFYTRLIYSM
SLTMFPTNNNSKMISHHHQNPKHNFILPTLTVLSTLTLPLSSQLIT
NT seq 1039 nt   +upstreamnt  +downstreamnt
ataaacccaatcaccctaatcattatttactttactatcctcatagggcctgtaatcact
atatctagctccaacttactcctaatatgagtaggattggaaataagccttttagctatc
atcccacttctagccaacaaaaaaagcccacgatcaactgaagcagcaacaaaatatttt
ctaacccaagctacagcctcaataattatcctactagtcatcatcctcaactacaaacaa
tcaggaatatgaaccctccaacaacaaaccaataacatactactcaacataatactcatt
tcactagccataaaacttggactagcccccttccactactgactacccgaagtcacccaa
ggaattcccctacacattggattaatcttactaacatgacaaaaaattgctccactatca
attctataccaattttatcaactcctaaacccaactatcaccaccattctcgcaatttca
tcagtctttgttggcgcctgaggaggacttaaccagacccaaacacgaaaaatcatagca
tattcatcaattgcccacataggatgaataacagcaatccttccatacaaccctaactta
accctcctaaacttaacaatttacatcctacttactgttccaatattcatcacactcata
acaaactcagcaacaacaatcaacacactctcactcgcatgaaataaaactcccataatc
ctaaccataacatccatcatcctcctatcactaggaggactcccccctctcacaggattt
ttaccaaaatgagcaattatctccgagcttctaaaaaacaactgctcaaccctatcaaca
ctaatagctatcatagccctattaagcctattcttctatacacgactaatttactctata
tccctcaccatattcccaaccaacaacaactccaaaataatctcccaccaccaccaaaac
ccaaaacataattttatcctcccaaccctcacagtattaagtacccttaccctaccgctt
tcctcccaactaatcacat

KEGG   Rattus norvegicus (rat): 26199
Entry
26199             CDS       T01003                                 

Gene name
ND3
Definition
(RefSeq) NADH dehydrogenase subunit 3
  KO
K03880  NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26199 (ND3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26199 (ND3)
  09159 Environmental adaptation
   04714 Thermogenesis
    26199 (ND3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26199 (ND3)
   05012 Parkinson disease
    26199 (ND3)
   05014 Amyotrophic lateral sclerosis
    26199 (ND3)
   05016 Huntington disease
    26199 (ND3)
   05020 Prion disease
    26199 (ND3)
   05022 Pathways of neurodegeneration - multiple diseases
    26199 (ND3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26199 (ND3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26199 (ND3)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26199 (ND3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26199 (ND3)
SSDB
Motif
Pfam: Oxidored_q4
Other DBs
NCBI-GeneID: 26199
NCBI-ProteinID: YP_665636
RGD: 620557
UniProt: P05506 Q8SEZ1
Position
MT
AA seq 115 aa
MNLLIIITINITLSFILISIAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAI
TFLLFDLEIALLLPLPWAIQTTNTTTMMATAFILVTILALGLSYEWTQKGLEWTE
NT seq 348 nt   +upstreamnt  +downstreamnt
attaacctacttattatcatcacaattaacatcaccttatcttttatcctcatttcaatt
gcattctgattgcctcaaataaacttatactccgaaaaagcaaacccatatgaatgtggc
ttcgacccaacaagttctgcacgccttcctttttcaataaaatttttcttagtagccatt
acatttctactattcgacctagaaatcgccttactactccccctcccatgagcgattcaa
acaaccaatactactacaataatagcaactgcctttattctagtcactattttagctctt
ggcctaagctacgaatgaacacaaaaaggactagaatgaacagaataa

KEGG   Rattus norvegicus (rat): 26200
Entry
26200             CDS       T01003                                 

Gene name
ND4L
Definition
(RefSeq) NADH dehydrogenase subunit 4L
  KO
K03882  NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26200 (ND4L)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26200 (ND4L)
  09159 Environmental adaptation
   04714 Thermogenesis
    26200 (ND4L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26200 (ND4L)
   05012 Parkinson disease
    26200 (ND4L)
   05014 Amyotrophic lateral sclerosis
    26200 (ND4L)
   05016 Huntington disease
    26200 (ND4L)
   05020 Prion disease
    26200 (ND4L)
   05022 Pathways of neurodegeneration - multiple diseases
    26200 (ND4L)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26200 (ND4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26200 (ND4L)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26200 (ND4L)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26200 (ND4L)
SSDB
Motif
Pfam: Oxidored_q2
Other DBs
NCBI-GeneID: 26200
NCBI-ProteinID: YP_665637
RGD: 620494
UniProt: P05507 Q7H113
Position
MT
AA seq 98 aa
MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIP
ITILVFAACEAAVGLALLVKISNTYGTDYVQNLNLLQC
NT seq 297 nt   +upstreamnt  +downstreamnt
atgacatctgctttcctaaatttaactatagcctttacattatctctactaggtactttt
atatttcgctcccacttaatatctactctcctctgcctagaaggaataatactatcacta
tttgtcataacttcaacatccacattaaactccaactccataatctccataaccatccca
attaccattctagtttttgcagcctgcgaagcagcagtaggtttagccttactagtaaaa
atttcaaatacttacggaacagactacgtacaaaacctcaaccttctacaatgttaa

KEGG   Rattus norvegicus (rat): 26201
Entry
26201             CDS       T01003                                 

Gene name
ND4
Definition
(RefSeq) NADH dehydrogenase subunit 4
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26201 (ND4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26201 (ND4)
  09159 Environmental adaptation
   04714 Thermogenesis
    26201 (ND4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26201 (ND4)
   05012 Parkinson disease
    26201 (ND4)
   05014 Amyotrophic lateral sclerosis
    26201 (ND4)
   05016 Huntington disease
    26201 (ND4)
   05020 Prion disease
    26201 (ND4)
   05022 Pathways of neurodegeneration - multiple diseases
    26201 (ND4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26201 (ND4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26201 (ND4)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26201 (ND4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26201 (ND4)
SSDB
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Other DBs
NCBI-GeneID: 26201
NCBI-ProteinID: YP_665638
RGD: 620559
UniProt: P05508 Q8HIC6
Position
MT
AA seq 459 aa
MLKIIFPSIMLLPLTWLSANKKIWTNVTSYSFLVSLLSLSLLWQNDENYLNFSVMFSSDP
LSTPLIILTTWLLPLMMLASQNHMKKENMMHQKLYISMLISLQILLIMTFSATELILFYI
LFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALISIQNSMGTLNFLILS
LTTHPLPSTWSNTILWLACMMAFMIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGG
YGMMRVSIILDPLTKSLAYPFIILSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVITA
IMIQTPWSFMGATMLMIAHGLTSSLLFCLANTNYERIHSRTMIMARGLQMIFPLMATWWL
LASLANLALPPLINLMGELFIVMATFSWSNPSIILMATNIVITGIYSMYMIITTQRGKLT
SHMNNLQPSHTRELTLMALHIIPLMLLTINPKLITGLTM
NT seq 1378 nt   +upstreamnt  +downstreamnt
atgttaaaaattattttcccatctatcatactcctcccactaacatgactctcagccaac
aaaaaaatctgaaccaatgtcacctcctacagctttctagtgagcctattaagcttatca
ctcctatgacaaaatgacgaaaattacctaaatttctcagttatattctcctccgatcca
ttatccaccccactaatcattctaacaacttgactcctcccactaataatgctcgctagc
caaaatcacataaaaaaagaaaatataatgcatcaaaaactttacatctcaatacttatt
agcctccaaattttactcatcataacattctccgcaacagaactaattttattttatatc
ctgttcgaagccactctaatcccaacactaattatcattacacgatgaggcaaccaaaca
gaacgcttaaatgcaggaatttatttcctattttatacactaattggctccatcccactc
ttaattgccctcatttcaatccaaaactcaataggaacactcaacttcctaatcctctcc
ctcacaacacaccccctaccctcaacatgatccaacaccattctatgactagcatgtata
atagcatttataatcaaaataccattatacggagtccatctatgattaccaaaagcccac
gtagaagctccaattgcaggctctataattttagcagcaattctcctaaagctagggggt
tatgggataatacgagtttccatcattctagaccccctaacaaaatctttagcctaccca
ttcatcatcctctcattatgaggcataattataactagctcaatctgcctacgccaaaca
gatctaaaatcattaattgcttactcatcagtaagccatatagccctagtcatcacagcc
attataatccagacaccatgaagcttcatgggagctacaatactaataatcgcccacggc
ttaacctcctcactcttattctgcctagcaaacaccaactacgaacgaattcacagccga
actataattatagctcgaggattacaaataatctttccattgatagcaacatgatgacta
ttagcaagcttagccaacctagcactaccacccctaattaacctcataggcgagttattc
attgttatagcaacattttcctgatcgaacccctctatcatccttatagcaactaacatt
gtcatcacaggaatctactcaatatatataattatcacaacccaacgaggaaaactaacc
agccacataaacaacctccaaccttcccacacacgagaattaacactcatagctctacac
attattcccctcatactattaacaatcaaccctaaactcatcacaggcctaacaatat

KEGG   Rattus norvegicus (rat): 26202
Entry
26202             CDS       T01003                                 

Gene name
ND5
Definition
(RefSeq) NADH dehydrogenase subunit 5
  KO
K03883  NADH-ubiquinone oxidoreductase chain 5 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26202 (ND5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26202 (ND5)
  09159 Environmental adaptation
   04714 Thermogenesis
    26202 (ND5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26202 (ND5)
   05012 Parkinson disease
    26202 (ND5)
   05014 Amyotrophic lateral sclerosis
    26202 (ND5)
   05016 Huntington disease
    26202 (ND5)
   05020 Prion disease
    26202 (ND5)
   05022 Pathways of neurodegeneration - multiple diseases
    26202 (ND5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26202 (ND5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26202 (ND5)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26202 (ND5)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26202 (ND5)
SSDB
Motif
Pfam: Proton_antipo_M NADH5_C Proton_antipo_N
Other DBs
NCBI-GeneID: 26202
NCBI-ProteinID: YP_665639
RGD: 620560
UniProt: P11661 Q8SEZ0
Position
MT
AA seq 609 aa
MNMMTSSILMILILLTTPIIISMTNLPKLIDFPSYATSSIKFSFLLSLLPLLLFFHHNTE
YMITNWHWLTINSIKLTMSFKIDYFSILFLSVALFVTWSIMQFSSWYMHSDPHINRFIKY
LMMFLITMLILTSANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILYNRVGDI
GFILAMTWFCLNMNSWELQQIFLTNTNNLVPLTGLLIAATGKSAQFGLHPWLPSAMEGPT
PVSALLHSSTMVVAGIFLMIRFHPLTSNNSTIMTAMLCLGAITTLFTAICALTQNDIKKI
VAFSTSSQLGLMMVTLGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGN
MMKAMPFTSSCLIIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALMITLIATSMTAV
YSMRIIYFVTMTKPRYSPLITINENNPNLINPIKRLALGSILAGFLISLNIPPTNIQILT
MPWHLKMTALLITILGFAIALELNNLTLNLSMSKPTKLSSFSTSLGYYPPIMHRIIPQKT
LNSSYKLSLNLLDLIWLEKTIPKSTSITQTQLSKMMSNQKGLIKLYFLSFLITISLIFIL
HTLNPEWFQ
NT seq 1830 nt   +upstreamnt  +downstreamnt
ataaatataataacatcctcaatcctcataatcttgattttacttacaacaccaatcatc
atttccataaccaacctaccaaaacttattgactttccgtcatatgctacttcatcaatt
aaattctcattcctccttagcctcttacctttactactattcttccaccacaacacagaa
tatataattactaactgacattgactaactattaattctattaaacttactataagtttc
aaaattgactatttctcaatcctattcctatcagtagccctattcgtaacatgatcaatc
atacaattctcttcatgatatatacactctgatccccacattaaccgattcattaagtac
ttaataatattcctaattactatactaattctaacctcagctaacaatctattccaactc
tttattggatgagaaggagtaggaattatatccttcttattaatcggatgatgatatggc
cgtgcagacgccaacacagcggccctccaagcaatcctctacaaccgagtcggagacatt
ggtttcatcctagctataacctgattctgcctaaacataaactcctgagaactccaacaa
attttcttaaccaataccaacaatctagtccctctcacaggactactaattgcagccaca
ggaaaatccgcccaattcggacttcatccatgactcccatcagctatagaaggcccaact
cccgtctctgccctactacactcaagcacaatagttgtggcagggatcttcctaataatc
cgattccaccccctaacctcaaacaatagtactattataacagccatactatgtcttggt
gcaatcaccacattattcacagcaatctgtgctctcacccaaaacgacatcaaaaaaatt
gtagctttctcaacatccagccaactaggccttataatagtcacattagggattaaccaa
ccctaccttgctttcctccacatttgcacccatgcattcttcaaagccatattattcata
tgctccggatcaatcatccatagcctcaacgatgaacaagacattcgaaaaataggcaat
ataataaaagcaataccattcacatcatcttgtctcattatcgggagcctagcccttacc
ggaatacctttcctcacaggattctattcaaaagatctcatcatcgaagccatcaacacg
tgtaacaccaacgcctgagccctaataatcactttaatcgccacatccataactgctgtg
tacagtatacgcatcatctacttcgtcaccatgacaaaaccacgatactccccactaatt
actattaatgaaaacaacccaaacctcattaatccaatcaaacgcctagcattaggaagc
atcctagcaggcttccttatctcactaaatattcctccaactaacattcaaattctcaca
ataccctgacatttaaaaataacagccctactcattacaatcctaggatttgccattgcc
ctagaacttaacaatttaacactaaatctatcaataagcaaacccaccaaactatcatca
ttctcaacctccctaggctactacccaccaattatacaccgaattattcctcaaaaaact
ctaaattctagctacaaattatccttaaacctactagacctaatctgactagaaaagaca
atcccaaaatcaacctcaatcacccaaacccaactatctaaaataatatccaaccaaaaa
gggctaatcaaactatatttcctatcatttctcatcactatttcactaatttttatctta
cacacacttaatcccgagtgatttcaataa

KEGG   Rattus norvegicus (rat): 26203
Entry
26203             CDS       T01003                                 

Gene name
ND6
Definition
(RefSeq) NADH dehydrogenase subunit 6
  KO
K03884  NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26203 (ND6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26203 (ND6)
  09159 Environmental adaptation
   04714 Thermogenesis
    26203 (ND6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26203 (ND6)
   05012 Parkinson disease
    26203 (ND6)
   05014 Amyotrophic lateral sclerosis
    26203 (ND6)
   05016 Huntington disease
    26203 (ND6)
   05020 Prion disease
    26203 (ND6)
   05022 Pathways of neurodegeneration - multiple diseases
    26203 (ND6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26203 (ND6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26203 (ND6)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26203 (ND6)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26203 (ND6)
SSDB
Motif
Pfam: Oxidored_q3
Other DBs
NCBI-GeneID: 26203
NCBI-ProteinID: YP_665640
RGD: 620561
UniProt: P03926 Q8HIC5
Position
MT
AA seq 172 aa
MTNYMFILSLLFLTGCLGLALKPSPIYGGLGLIVSGCIGCLMVLGFGGSFLGLMVFLIYL
GGMLVVFGYTTAMATEEYPETWGSNWFIFSFFVLGLFMELVVFYLFSLNNKVELVDFDSL
GDWLMYEIDDVGVMLEGGIGVAAIYSCATWMMVVAGWSLFAGIFIIIEITRD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgacaaattatatgtttattttaagtttactgtttttgactggttgtctagggttggcg
ttgaagccttcacctatttatggtgggcttggattgattgttagtggatgtattgggtgc
ttaatagttttagggtttgggggttcgtttttaggtttaatagtatttttaatttatttg
ggggggatgttggttgtatttgggtatacaactgctatggctactgaggagtacccggag
acttgagggtctaattggtttatttttagtttttttgttttagggctttttatggagttg
gtagtgttctacttgtttagtttgaataataaggtggagttagttgattttgatagtcta
ggcgattgattaatgtatgagattgatgatgttggggttatgttggagggggggattggg
gttgcggctatttatagttgtgctacttgaatgatagtggtggctgggtggtcattgttt
gcggggatttttattattattgaaatcactcgggattaa

KEGG   Rattus norvegicus (rat): 288088
Entry
288088            CDS       T01003                                 

Gene name
Ndufb4
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    288088 (Ndufb4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    288088 (Ndufb4)
  09159 Environmental adaptation
   04714 Thermogenesis
    288088 (Ndufb4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    288088 (Ndufb4)
   05012 Parkinson disease
    288088 (Ndufb4)
   05014 Amyotrophic lateral sclerosis
    288088 (Ndufb4)
   05016 Huntington disease
    288088 (Ndufb4)
   05020 Prion disease
    288088 (Ndufb4)
   05022 Pathways of neurodegeneration - multiple diseases
    288088 (Ndufb4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    288088 (Ndufb4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    288088 (Ndufb4)
SSDB
Motif
Pfam: NDUF_B4 Phage_holin_2_4
Other DBs
NCBI-GeneID: 288088
NCBI-ProteinID: NP_001032415
RGD: 1307072
Ensembl: ENSRNOG00000002721
UniProt: F1LPG5
Position
11
AA seq 129 aa
MSFSKYKPAPLAALPNTLDPAEYDVSPETRKAQVERMSIRARLKREYLLQYNDPKRQTHI
EDPALIRWTYARSANVYPNFRPTPKNSLLGAVAGLGPLIFWYYVIKTDRDKKERLIQEGK
LDRKFSISY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgttttccaagtataagcctgcacccctggccgctctccccaataccctcgacccc
gccgagtatgacgtgtctccggagacccgaaaggcgcaggtcgagcgcatgagcataagg
gcccggcttaaacgggagtatctgcttcagtacaacgaccccaaacgccaaacgcacatc
gaggatcctgccttgattcgttggacctatgcaagatcagcaaatgtttatcctaatttc
agacccactcccaagaactcacttttaggagcagtggcaggtttagggcctctcatcttc
tggtattacgttatcaaaacagacagggacaaaaaggaaagacttatccaggaaggaaaa
ctggacagaaaatttagcatctcctactaa

KEGG   Rattus norvegicus (rat): 289218
Entry
289218            CDS       T01003                                 

Gene name
Ndufs2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial precursor
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    289218 (Ndufs2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    289218 (Ndufs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    289218 (Ndufs2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289218 (Ndufs2)
   05012 Parkinson disease
    289218 (Ndufs2)
   05014 Amyotrophic lateral sclerosis
    289218 (Ndufs2)
   05016 Huntington disease
    289218 (Ndufs2)
   05020 Prion disease
    289218 (Ndufs2)
   05022 Pathways of neurodegeneration - multiple diseases
    289218 (Ndufs2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    289218 (Ndufs2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    289218 (Ndufs2)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     289218 (Ndufs2)
SSDB
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Other DBs
NCBI-GeneID: 289218
NCBI-ProteinID: NP_001011907
RGD: 1307109
Ensembl: ENSRNOG00000038372
UniProt: Q641Y2
Position
13
AA seq 463 aa
MAALRAVCSLRGVGAQVLRAGSGIRLPSQPSRGARRWQPDIEWAEQFSGAVMYPSKETAH
WKPPPWNDVDVLKEKVVTNVTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRI
LNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
MDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVSAEDALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggccctcagggctgtgtgcagcctccgcggtgtcggggcccaggtgctgcgggcc
gggtctgggattcgtctgccgagtcagcccagcagaggtgctcggcgatggcagccagat
atagaatgggcagagcagttttcgggagctgtcatgtatccctccaaggaaacagcccac
tggaaacctcctccttggaatgatgtggatgttttgaaggagaaagtggtgaccaacgtg
accctgaactttgggccccagcacccagcagctcatggagtcctgagactcgtgctggaa
ttgagtggagagatggtgcggaaatgtgaccctcacatcgggctcctacaccgaggcacg
gagaagctcatcgagtacaagacctatctgcaggcccttccatattttgaccggttggac
tatgtgtccatgatgtgtaatgaacaggcgtattcactagctgtggagaagttgctaaac
atccagcctcctccccgggcgcagtggatccgagtgctctttggagagatcacacggatt
ttaaaccatatcatggctgtcaccacacatgccctggacattggtgccatgacgcctttc
ttctggatgtttgaagaaagggagaagatgttcgagttctatgagcgggtgtctggagcc
cgtatgcatgctgcttatatccgaccaggaggagtgcaccaggacctacctcttgggctt
atggatgacatttatgaattttccaagaacttctctcttcggattgatgaggtggaggag
atgctgaccaacaatagaatctggcgaaataggacagtcgacattggggttgtatctgca
gaagatgcactgaactatggattcagtggagtgatgctccgaggctcaggcatccagtgg
gacttgcggaagacccagccatatgatgtttacgaccaggtggagtttgatgttcctatt
ggttctcgaggggactgctacgataggtatctgtgtcgtgtggaagagatgcgccagtcc
cttcgaatcatcgaacagtgtctgaacaagatgccgccgggggagatcaaggttgatgac
gccaaagtgtccccacctaaacgagcagagatgaagacgtccatggagtcactaattcat
cactttaagctgtatactgagggctaccaagttcctccaggagccacatacaccgccatt
gaagctcctaagggcgagtttggggtgtacttggtatctgatggcagcagccgaccttat
cggtgtaagatcaaggctcccggttttgcccacctggcaggtttggacaagatgtctaaa
ggacacatgctggcagatgtcgtagccatcataggcacccaggatattgtatttggagaa
atagaccgatga

KEGG   Rattus norvegicus (rat): 291660
Entry
291660            CDS       T01003                                 

Gene name
Ndufa2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291660 (Ndufa2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    291660 (Ndufa2)
  09159 Environmental adaptation
   04714 Thermogenesis
    291660 (Ndufa2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291660 (Ndufa2)
   05012 Parkinson disease
    291660 (Ndufa2)
   05014 Amyotrophic lateral sclerosis
    291660 (Ndufa2)
   05016 Huntington disease
    291660 (Ndufa2)
   05020 Prion disease
    291660 (Ndufa2)
   05022 Pathways of neurodegeneration - multiple diseases
    291660 (Ndufa2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    291660 (Ndufa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    291660 (Ndufa2)
SSDB
Motif
Pfam: L51_S25_CI-B8 Lipase_GDSL_3
Other DBs
NCBI-GeneID: 291660
NCBI-ProteinID: NP_001099623
RGD: 1309997
Ensembl: ENSRNOG00000017571
UniProt: D3ZS58
Position
18
AA seq 97 aa
MAAASRVVGAKQVLREIRIHLCQRSPGSQGVRDFIQQRYVELKKAHPDLPILIRECSEVQ
PKLWARYAFGQEKNVSLNNLSAAEVTKAMENVLSGKA
NT seq 294 nt   +upstreamnt  +downstreamnt
atggcggccgcaagccgagtagtcggtgcaaagcaggtactgcgtgagattcgcattcac
ttatgccagcgttccccaggcagccagggtgtgagagatttcatccagcaacggtacgtg
gagctgaagaaggcgcaccccgacctgcccattctaatccgcgaatgttcagaggtgcag
cccaagctctgggcccgttatgcttttggccaagagaagaatgtgtctctgaacaatctg
agtgctgctgaggtgaccaaagccatggagaatgtgctaagtggcaaagcatga

KEGG   Rattus norvegicus (rat): 293130
Entry
293130            CDS       T01003                                 

Gene name
Ndufc2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 subunit C2
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293130 (Ndufc2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293130 (Ndufc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    293130 (Ndufc2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293130 (Ndufc2)
   05012 Parkinson disease
    293130 (Ndufc2)
   05014 Amyotrophic lateral sclerosis
    293130 (Ndufc2)
   05016 Huntington disease
    293130 (Ndufc2)
   05020 Prion disease
    293130 (Ndufc2)
   05022 Pathways of neurodegeneration - multiple diseases
    293130 (Ndufc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293130 (Ndufc2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293130 (Ndufc2)
SSDB
Motif
Pfam: NDUF_C2
Other DBs
NCBI-GeneID: 293130
NCBI-ProteinID: NP_001009290
RGD: 1307511
Ensembl: ENSRNOG00000012383
UniProt: Q5PQZ9
Position
1
AA seq 120 aa
MMNGRPGHEPLRFLPDEARRLPPPKLNDPRLVYIGFLGYCTGLMDNMMRMRPVMKAGLHR
QLLYVTSFFFAGYFYLKRQNYLYAVRDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatgaacggccggccgggccatgagcccttaagattcttgccggatgaggcccggaga
ctgcccccgcccaagctgaacgacccgcggcttgtctacatcggcttcctgggctactgc
acgggcctgatggacaacatgatgcgaatgagacctgtgatgaaagcaggtttgcatcgc
cagcttctgtatgttacttcctttttctttgctggatatttttatttaaaacgtcaaaac
tatctgtatgctgtgagggaccatgacatgttcgggtatataaaattacatccagaagat
tttcctgagaaagagaagaaaacttatgctgaaattcttgagccattccatccagtgcgt
tga

KEGG   Rattus norvegicus (rat): 293453
Entry
293453            CDS       T01003                                 

Gene name
Ndufab1
Definition
(RefSeq) acyl carrier protein, mitochondrial
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293453 (Ndufab1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    293453 (Ndufab1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293453 (Ndufab1)
  09159 Environmental adaptation
   04714 Thermogenesis
    293453 (Ndufab1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293453 (Ndufab1)
   05012 Parkinson disease
    293453 (Ndufab1)
   05014 Amyotrophic lateral sclerosis
    293453 (Ndufab1)
   05016 Huntington disease
    293453 (Ndufab1)
   05020 Prion disease
    293453 (Ndufab1)
   05022 Pathways of neurodegeneration - multiple diseases
    293453 (Ndufab1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293453 (Ndufab1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293453 (Ndufab1)
SSDB
Motif
Pfam: PP-binding PP-binding_2
Other DBs
NCBI-GeneID: 293453
NCBI-ProteinID: NP_001099764
RGD: 1305619
Ensembl: ENSRNOG00000018129
UniProt: D3ZF13
Position
1
AA seq 156 aa
MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTILCPEGIWRRTGTLQPTLALAQVPGT
VTHLCRQYSDAPPLTLEGIRDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYD
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcgtctcgtgtcctttgcgcctgtgtccgccgcctgcctgcggcctttgcgccgctg
ccccggcttcccacgttggctttggcccggccgctcagcaccattctctgccctgaggga
atctggagaagaaccgggactctgcagcccaccttggcgctcgcgcaggtgcctggaacg
gtcacacatttgtgccgccagtacagtgatgcacccccactgacgttagaaggaatcagg
gaccgagttctgtatgtcttgaaactctatgataagattgacccagaaaagctctcagta
aattctcattttatgaaggacctgggcttagacagtttggaccaagtggaaattattatg
gccatggaagacgaatttgggtttgaaattcctgatatagatgcagagaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtgtatgactaa

KEGG   Rattus norvegicus (rat): 293652
Entry
293652            CDS       T01003                                 

Gene name
Ndufs8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293652 (Ndufs8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293652 (Ndufs8)
  09159 Environmental adaptation
   04714 Thermogenesis
    293652 (Ndufs8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293652 (Ndufs8)
   05012 Parkinson disease
    293652 (Ndufs8)
   05014 Amyotrophic lateral sclerosis
    293652 (Ndufs8)
   05016 Huntington disease
    293652 (Ndufs8)
   05020 Prion disease
    293652 (Ndufs8)
   05022 Pathways of neurodegeneration - multiple diseases
    293652 (Ndufs8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293652 (Ndufs8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293652 (Ndufs8)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     293652 (Ndufs8)
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_8 Fer4_4 Fer4_2 Fer4_17 c-SKI_SMAD_bind Fer4_3
Other DBs
NCBI-GeneID: 293652
NCBI-ProteinID: NP_001099792
RGD: 1309436
Ensembl: ENSRNOG00000017446
UniProt: B0BNE6
Position
1
AA seq 212 aa
MYRLSSSVLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNMKAQELDVDMKSATDSAARI
LMWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH
EELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgtaccgcctgagctcgtcagtgctgccccgggccttggcccaggccatgcgcacagga
catcttaatggccaaagccttcatagcagtgcagtggccgctacgtacaagtatgtgaat
atgaaggcacaggaacttgatgtggacatgaagtctgcgactgacagtgcagctcggatt
ctgatgtggacagaactcttccgaggcctgggcatgaccctaagctacctctttcgggag
cccgccaccatcaactacccctttgagaagggcccactgagtccgcgcttccgtggggag
catgcactgcgccgctacccgtctggggaggagcgttgcatcgcctgcaagctctgtgag
gccatctgtcctgcacaggccatcaccattgaggctgagccaagagcagatggcagccgc
cggactacacgctatgacattgacatgaccaagtgtatctactgtggtttctgccaggaa
gcctgccctgttgacgctatcgtggagggccccaactttgagttctccaccgagacgcat
gaggagttgctgtacaacaaggagaagctactcaacaatggtgacaagtgggaggccgag
atcgcggccaacatccaggctgactacctgtatcggtga

KEGG   Rattus norvegicus (rat): 293655
Entry
293655            CDS       T01003                                 

Gene name
Ndufv1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293655 (Ndufv1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293655 (Ndufv1)
  09159 Environmental adaptation
   04714 Thermogenesis
    293655 (Ndufv1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293655 (Ndufv1)
   05012 Parkinson disease
    293655 (Ndufv1)
   05014 Amyotrophic lateral sclerosis
    293655 (Ndufv1)
   05016 Huntington disease
    293655 (Ndufv1)
   05020 Prion disease
    293655 (Ndufv1)
   05022 Pathways of neurodegeneration - multiple diseases
    293655 (Ndufv1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293655 (Ndufv1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293655 (Ndufv1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     293655 (Ndufv1)
SSDB
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Other DBs
NCBI-GeneID: 293655
NCBI-ProteinID: NP_001006973
RGD: 1359247
Ensembl: ENSRNOG00000018117
UniProt: Q5XIH3
Position
1
AA seq 464 aa
MLAARHFLGGSVPVRVSVRLSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACDSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVLGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMNSS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHQARQAAS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgctagcagcacggcattttctcggcgggtcggttcccgtgcgggtatctgtgcgtctc
agcagcggcacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg
atcttcaccaacctgtatgggcgccatgactggaggctgaagggtgcccagaggcggggt
gattggtacaagacaaaggagatcctgctgaaggggcctgactggatcttgggtgaaatg
aagacatcgggtttacggggccgtggtggtgctggcttccccactggcctcaaatggagc
tttatgaataagccctcggatggcaggcccaagtacctggtggtgaatgctgacgagggt
gagcccggcacctgtaaggaccgagagatcatgcgccatgaccctcacaagctggtggaa
ggctgcctggtgggaggccgggccatgggggcccgggctgcctatatctacatccgaggg
gaattctacaatgaggcctccaatttgcaggtagctatccgagaggcctatgaagcaggt
ctgattggcaaaaatgcctgtgactctgattatgattttgatgtgtttgtggtgcgtggg
gctggggcctacatctgtggagaagagactgcgcttattgagtccattgaaggcaagcag
ggaaagccacgcctgaagccgccctttccagcagatgtgggagtatttggatgccccaca
actgtggccaatgtggagacggtggctgtgtcccccaccatctgccgtcgtggcggcacc
tggtttgctggctttggccgagaacgcaactcaggtaccaaactgttcaacatctctggc
catgtcaaccacccctgcactgtggaggaagagatgtctgtgccactcaaagaactgatt
gagaaacatgctggtggtgtcttaggtggctgggacaacctccttgctgtgattcctggt
ggctcatccactccactgatccccaaatctgtgtgtgagacagtgctgatggactttgat
gccctggtgcaggctcagacgggcctgggcacagctgcggttattgttatgaacagctcg
acagacattgtgaaagccatcgctcgtctcattgagttctacaagcatgagagctgtggc
cagtgcaccccgtgccgggagggcgttgattggatgaacaaggtgatggcccgatttgtg
aagggggatgcccggccagctgagatcgactccctgtgggagatcagcaagcagatagaa
ggccacaccatttgtgctctgggtgatggggccgcctggccagtacagggtctgatccga
catttccggcccgagcttgaggatcggatgcaacgatttgcccagcagcaccaggccagg
caggcggcctcctga

KEGG   Rattus norvegicus (rat): 293991
Entry
293991            CDS       T01003                                 

Gene name
Ndufb8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293991 (Ndufb8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293991 (Ndufb8)
  09159 Environmental adaptation
   04714 Thermogenesis
    293991 (Ndufb8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293991 (Ndufb8)
   05012 Parkinson disease
    293991 (Ndufb8)
   05014 Amyotrophic lateral sclerosis
    293991 (Ndufb8)
   05016 Huntington disease
    293991 (Ndufb8)
   05020 Prion disease
    293991 (Ndufb8)
   05022 Pathways of neurodegeneration - multiple diseases
    293991 (Ndufb8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    293991 (Ndufb8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293991 (Ndufb8)
SSDB
Motif
Pfam: NDUF_B8
Other DBs
NCBI-GeneID: 293991
NCBI-ProteinID: NP_001099830
RGD: 1309129
Ensembl: ENSRNOG00000014078
UniProt: B2RYS8
Position
1
AA seq 186 aa
MAASRAAALGVRWLQRTSRCVVPLEARRAFHMTKDMMPGSYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPMLPNRSQHERDPWYEWDHPDLRLNWGEPIHWDLDMYIRNRVDTS
PTPVSWDVMCRHLFGFVAFMVFMFWVGDMFPSYQPVGPKQYPYNNLYLERGGDPSKEPEP
VVHYEI
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcggcgtcccgggctgcggccctgggagtccggtggctgcaaaggacatcccgctgc
gtggtgccacttgaggcacggagagccttccacatgaccaaggacatgatgccggggtca
tatcctaggaccccagaagaacgggccgcggccgccaagaagtataatatgcgtgtggaa
gactacgagccgtacccagatgatggcatggggtatggtgactacccgatgctccctaac
cgctcacagcatgagagggatccgtggtatgaatgggaccacccagacctcaggctgaac
tggggtgaaccgatacactgggacctagacatgtacatcaggaatcgtgtggacacatct
cctacaccggtttcctgggatgtcatgtgtagacatctcttcggctttgtggctttcatg
gttttcatgttctgggtaggggacatgttcccttcctaccagcctgtgggtccgaagcag
tacccgtacaataatctgtacctggagcgaggcggtgatccttccaaagaacctgagccc
gtggttcactatgagatctga

KEGG   Rattus norvegicus (rat): 29478
Entry
29478             CDS       T01003                                 

Gene name
Ndufs6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursor
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29478 (Ndufs6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    29478 (Ndufs6)
  09159 Environmental adaptation
   04714 Thermogenesis
    29478 (Ndufs6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29478 (Ndufs6)
   05012 Parkinson disease
    29478 (Ndufs6)
   05014 Amyotrophic lateral sclerosis
    29478 (Ndufs6)
   05016 Huntington disease
    29478 (Ndufs6)
   05020 Prion disease
    29478 (Ndufs6)
   05022 Pathways of neurodegeneration - multiple diseases
    29478 (Ndufs6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29478 (Ndufs6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29478 (Ndufs6)
SSDB
Motif
Pfam: zf-CHCC Thiolase_C
Other DBs
NCBI-GeneID: 29478
NCBI-ProteinID: NP_062096
RGD: 3156
Ensembl: ENSRNOG00000018068
UniProt: P52504
Position
2
AA seq 116 aa
MAAALTFRRLLALPRAARGFGVRVSLSGEKITHTGQVSDGKDYRGIRFVDRQKEVNENFA
IDLIAQQPVNEVDRRIIACDGGGGALGHPKVYINLDKETKTGTCAYCGLQFKQQHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcggcggcgctgaccttccgccgtctgttggctctccctagggctgcccggggtttc
ggggtgcgagtgtcgctgagcggggagaagatcacgcataccggccaggtgtctgatgga
aaagactacagggggattcgttttgtagatcgtcagaaagaggtgaatgagaactttgcc
attgatttgatagcacaacaacctgtgaatgaggtggaccgtcgtatcatagcctgtgat
ggagggggtggagccttgggccaccccaaggtgtatataaacctggacaaagaaacaaaa
acgggtacgtgtgcctactgcggcctgcagttcaagcagcagcatcactag

KEGG   Rattus norvegicus (rat): 294964
Entry
294964            CDS       T01003                                 

Gene name
Ndufb5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    294964 (Ndufb5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    294964 (Ndufb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    294964 (Ndufb5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    294964 (Ndufb5)
   05012 Parkinson disease
    294964 (Ndufb5)
   05014 Amyotrophic lateral sclerosis
    294964 (Ndufb5)
   05016 Huntington disease
    294964 (Ndufb5)
   05020 Prion disease
    294964 (Ndufb5)
   05022 Pathways of neurodegeneration - multiple diseases
    294964 (Ndufb5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    294964 (Ndufb5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    294964 (Ndufb5)
SSDB
Motif
Pfam: NDUF_B5 PanZ
Other DBs
NCBI-GeneID: 294964
NCBI-ProteinID: NP_001099896
RGD: 1305909
Ensembl: ENSRNOG00000011949
UniProt: D4A565
Position
2
AA seq 189 aa
MAAMSLLQRASVAALTALSGRRAGTRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVIKPS
LYYDARFLRLMKFYLLLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRW
IARTFYDGPEKNYEKTLAILQIESEKADLRLKELEVRRLMRARGDGPWYQYPTPEKEFID
YSPKSTPDN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcggctatgagcctgctgcagcgggcttcggtcgccgctctgacagctctgtctggc
cgccgcgctggcactaggctcggagtcggaagttttctcacacggagctttccgaagact
gtcgctcctgtgcggcacagtggggaccatggcaagagactgtttgtcatcaagccttcc
ttatactatgacgcccgcttcctgagattaatgaaattctaccttttgttgactgggatc
ccagttataatcggcataacactggtgaacatatttattggtgaagctgaactcgcagaa
atcccagaaggctacatcccagaacactgggagtattacaagcatccaatatcacgatgg
attgcccggactttctacgatggacctgaaaagaactatgaaaagaccctggctatcctc
cagatcgagtctgaaaaggccgacttacggttaaaggagctggaggttcgaagactgatg
cgtgcccggggtgatggaccttggtatcaatatccaacccctgaaaaggagttcattgat
tattctccaaaatcaactcctgacaactga

KEGG   Rattus norvegicus (rat): 295923
Entry
295923            CDS       T01003                                 

Gene name
Ndufs3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    295923 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    295923 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    295923 (Ndufs3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    295923 (Ndufs3)
   05012 Parkinson disease
    295923 (Ndufs3)
   05014 Amyotrophic lateral sclerosis
    295923 (Ndufs3)
   05016 Huntington disease
    295923 (Ndufs3)
   05020 Prion disease
    295923 (Ndufs3)
   05022 Pathways of neurodegeneration - multiple diseases
    295923 (Ndufs3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    295923 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    295923 (Ndufs3)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     295923 (Ndufs3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 295923
NCBI-ProteinID: NP_001099959
RGD: 1309406
Ensembl: ENSRNOG00000009155
UniProt: D3ZG43
Position
3
AA seq 264 aa
MASAAARVWCRGLLGAASVARGAGRPSVLLQQRVRRESAAADKRPTVRPSSDVTHKRLSA
FGEYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFGVFFFN
HPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPAYRQPPEHLKLEAGDKKPEAK
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgtctgctgcagccagggtctggtgccgtgggctcttgggggctgcttccgtagcc
aggggggctgggcgaccctcagtgctgttgcagcagcgtgtgagaagggagagcgcggcg
gctgacaagcgccccactgtcagaccctcgagtgatgtaacccacaagcggctctcagca
tttggagagtatgtggctgaaatcttacctaagtatgtccaacaagttcaggtgacctgc
tttgatgagttagaaatctgcatccatcctgatggagtcatcccaacgataacctttctc
aaggatcataccaatgcacagttcaaatccttggctgacttgacagcagtggatgtccca
actcggcagaaccgttttgagattgtctacaacctgctgtccctgcggtttaactctagg
attcgtgtgaagacctatgcagatgagctgacagccattgactccatagtgtctgtgcac
attgcggccaattggtatgagagggaggtctgggacatgtttggagttttcttcttcaac
caccctgacttgagaaggatcctgacagattatggcttcgagggacatcctttccggaaa
gactttcccctcactggctatgttgagctacgttatgacgatgaggtgaagcgggtagtg
gctgagccagtggagttggcacaagagttccgcaagtttgacctgaacagcccctgggag
gctttccctgcctatcgtcagccccctgagcatctcaagcttgaagctggagacaagaag
cctgaagccaagtaa

KEGG   Rattus norvegicus (rat): 296658
Entry
296658            CDS       T01003                                 

Gene name
Ndufa8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    296658 (Ndufa8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    296658 (Ndufa8)
  09159 Environmental adaptation
   04714 Thermogenesis
    296658 (Ndufa8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    296658 (Ndufa8)
   05012 Parkinson disease
    296658 (Ndufa8)
   05014 Amyotrophic lateral sclerosis
    296658 (Ndufa8)
   05016 Huntington disease
    296658 (Ndufa8)
   05020 Prion disease
    296658 (Ndufa8)
   05022 Pathways of neurodegeneration - multiple diseases
    296658 (Ndufa8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    296658 (Ndufa8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    296658 (Ndufa8)
SSDB
Motif
Pfam: CHCH Cmc1
Other DBs
NCBI-GeneID: 296658
NCBI-ProteinID: NP_001041327
RGD: 1306283
Ensembl: ENSRNOG00000005668
UniProt: Q7TP78
Position
3
AA seq 189 aa
MLDEFERELPDFIGYEEAGEGTRLPLRSLLSLVMVKVSSAVLKAAAHHYGAQCDKTNKEF
MLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSSMQLFRHCRKQ
QAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPEPSPVIEGDLKPAKH
GSRFFFWNV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggatgaatttgagagggaactgccggacttcatcggttatgaagaagcaggcgag
gggacacggttacctctcaggtccctgctctctttggtgatggtgaaagtcagctcagcc
gtgcttaaagctgccgcccatcactatggggctcagtgcgataagaccaataaggagttc
atgctgtgccgctgggaagagaaggaccctaggcgctgcctgaaggagggcaagctggtc
aacggctgcgcactgaacttcttccggcagatcaagagtcactgtgcggagcctttcaca
gagtactggacttgccttgattattccagcatgcagctgtttcgtcactgccgcaaacag
caggcaaagtttgacgaatgtgtgttggacaaactgggctgggtgaggcctgaccttggg
gagttgtctaaggtcaccaaagtgaaaacagatcgccctttgccagagaatccttatcac
tcaagaccaaggccagagcccagccccgtgatcgaaggggatctgaagcctgccaagcac
ggcagccgctttttcttctggaacgtgtaa

KEGG   Rattus norvegicus (rat): 297990
Entry
297990            CDS       T01003                                 

Gene name
Ndufb6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297990 (Ndufb6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    297990 (Ndufb6)
  09159 Environmental adaptation
   04714 Thermogenesis
    297990 (Ndufb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    297990 (Ndufb6)
   05012 Parkinson disease
    297990 (Ndufb6)
   05014 Amyotrophic lateral sclerosis
    297990 (Ndufb6)
   05016 Huntington disease
    297990 (Ndufb6)
   05020 Prion disease
    297990 (Ndufb6)
   05022 Pathways of neurodegeneration - multiple diseases
    297990 (Ndufb6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    297990 (Ndufb6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    297990 (Ndufb6)
SSDB
Motif
Pfam: NDUF_B6
Other DBs
NCBI-GeneID: 297990
NCBI-ProteinID: NP_001100116
RGD: 1311354
Ensembl: ENSRNOG00000024539
UniProt: D3ZZ21
Position
5
AA seq 128 aa
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWNNFLRDRALWKYM
IFKAYRTSLFTVSHVIIPLWFVHYYVKYHVATKPYAIVGTKPRIFPGDTILETGEVIPPM
RDFPDKHH
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtcggggtacacgcccgatgagaagctgcggctgcagcagctgcgggagctgagaagg
cgatggctgaaggaccaagagctgagcccccgggagcccgtgttgcccccgcgcaggatg
tggcccctggagcgattctggaataactttttgcgggaccgggccctgtggaagtacatg
atcttcaaggcgtaccgcaccagtctcttcactgtttcccatgtgatcatacctctctgg
ttcgtccactattacgtcaaatatcatgtggctactaaaccatatgccattgttggcacg
aagcccagaatatttccaggtgatacaattctggagactggagaagtaattccaccaatg
agagattttcctgataaacatcattga

KEGG   Rattus norvegicus (rat): 299310
Entry
299310            CDS       T01003                                 

Gene name
Ndufb11
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
  KO
K11351  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299310 (Ndufb11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    299310 (Ndufb11)
  09159 Environmental adaptation
   04714 Thermogenesis
    299310 (Ndufb11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299310 (Ndufb11)
   05012 Parkinson disease
    299310 (Ndufb11)
   05014 Amyotrophic lateral sclerosis
    299310 (Ndufb11)
   05016 Huntington disease
    299310 (Ndufb11)
   05020 Prion disease
    299310 (Ndufb11)
   05022 Pathways of neurodegeneration - multiple diseases
    299310 (Ndufb11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    299310 (Ndufb11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    299310 (Ndufb11)
SSDB
Motif
Pfam: ESSS
Other DBs
NCBI-GeneID: 299310
NCBI-ProteinID: NP_001100226
RGD: 1563698
Ensembl: ENSRNOG00000008329
UniProt: D4A7L4
Position
X
AA seq 151 aa
MAARLLSLYARRLSVAAAIREVPAARVRWESSRAVIAPSGVERKRQREPTMVWQEDPEPE
DENLYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYLPDYRMQEWARREA
ERLVKYRELNGLPIMESNYFDPSKIQLPEDD
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcggcccggctgttaagcttgtatgctcgccgcctgtcagtagcggcggcgatacga
gaggtcccggctgcccgtgttcgctgggaatcttccagggctgtaatcgccccgtccggt
gtggagagaaagcggcaaagagaaccgaccatggtatggcaggaggacccagaacccgag
gacgaaaacctctacgcgaagaacccagactttcacggttatgacagtgaccctgtggtg
gacgtctggaatatgcgagctgtcttcttctttggtttttccatcgtcctggtttttggt
accacctttgtggcttacctgcctgattacaggatgcaagagtgggcccgccgggaagct
gagagacttgtgaaataccgagaactcaacggcctccccatcatggaatccaactatttt
gatcccagcaagatccagttaccagaagatgactga

KEGG   Rattus norvegicus (rat): 299643
Entry
299643            CDS       T01003                                 

Gene name
Ndufa7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
  KO
K03951  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299643 (Ndufa7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    299643 (Ndufa7)
  09159 Environmental adaptation
   04714 Thermogenesis
    299643 (Ndufa7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299643 (Ndufa7)
   05012 Parkinson disease
    299643 (Ndufa7)
   05014 Amyotrophic lateral sclerosis
    299643 (Ndufa7)
   05016 Huntington disease
    299643 (Ndufa7)
   05020 Prion disease
    299643 (Ndufa7)
   05022 Pathways of neurodegeneration - multiple diseases
    299643 (Ndufa7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    299643 (Ndufa7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    299643 (Ndufa7)
SSDB
Motif
Pfam: CI-B14_5a
Other DBs
NCBI-GeneID: 299643
NCBI-ProteinID: NP_001100242
RGD: 1304597
Ensembl: ENSRNOG00000006939
UniProt: A9UMV9
Position
7
AA seq 112 aa
MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGR
REVVPPSIIMSSQKALVSGKTAESSAVAATKRAVTPAPPMKRWELSRDQPYL
NT seq 339 nt   +upstreamnt  +downstreamnt
atggcgtccgctactcgcgttatccaaaagcttcggaactgggcgtctgggcaagacctg
caggcgaagctgcagctgcgctaccaggagatcgccaagcggacccagccacctccgaag
ctccctgtgggccccagtcacaagctgtccaacaattactactgtactcgtgatggccgc
cgggaagttgtgcctccctcaatcatcatgtcctcacaaaaggccctggtgtcgggcaag
acagctgagagttctgctgtggcagccactaagagggcagtgacacctgctcctcccatg
aagaggtgggagctgtcaagggaccagccgtacctgtga

KEGG   Rattus norvegicus (rat): 299739
Entry
299739            CDS       T01003                                 

Gene name
Ndufa12
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299739 (Ndufa12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    299739 (Ndufa12)
  09159 Environmental adaptation
   04714 Thermogenesis
    299739 (Ndufa12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299739 (Ndufa12)
   05012 Parkinson disease
    299739 (Ndufa12)
   05014 Amyotrophic lateral sclerosis
    299739 (Ndufa12)
   05016 Huntington disease
    299739 (Ndufa12)
   05020 Prion disease
    299739 (Ndufa12)
   05022 Pathways of neurodegeneration - multiple diseases
    299739 (Ndufa12)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    299739 (Ndufa12)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    299739 (Ndufa12)
SSDB
Motif
Pfam: NDUFA12
Other DBs
NCBI-GeneID: 299739
NCBI-ProteinID: NP_001100251
RGD: 1311462
Ensembl: ENSRNOG00000007407
UniProt: F1LXA0
Position
7
AA seq 145 aa
MEQLRVLKRGLQQVTGHGGLRGLLRVFFRANDIRLGTLVGEDKYGNKYYEDNKQFFGRHR
WVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTKPLTARKFIWTNHKFNVSAT
PEQYVPYSTTRKKIQEWVPPSTPYK
NT seq 438 nt   +upstreamnt  +downstreamnt
atggagcaactgcgggtcctgaagcgcgggctgcagcaggtcaccggccacggcggcctg
cggggcctcctacgggttttcttcagggcaaatgatataaggctcggtaccttggtgggg
gaagacaaatacggaaacaaatactacgaagacaacaagcagttttttggccgtcaccga
tgggtcatatacaccaccgaaatgaatggcaaaaacacattctgggatgtggatggaagc
atggtgcctcctgaatggcaccgctggcttcactgcatgactgacgaccctccaacaaca
aaaccactgactgctcgtaagttcatttggacaaaccataagttcaatgtgagtgctact
ccagagcaatacgtcccttactccaccaccaggaagaagatccaagaatgggtgccaccc
tcgacaccttacaagtga

KEGG   Rattus norvegicus (rat): 299954
Entry
299954            CDS       T01003                                 

Gene name
Ndufb9
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299954 (Ndufb9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    299954 (Ndufb9)
  09159 Environmental adaptation
   04714 Thermogenesis
    299954 (Ndufb9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299954 (Ndufb9)
   05012 Parkinson disease
    299954 (Ndufb9)
   05014 Amyotrophic lateral sclerosis
    299954 (Ndufb9)
   05016 Huntington disease
    299954 (Ndufb9)
   05020 Prion disease
    299954 (Ndufb9)
   05022 Pathways of neurodegeneration - multiple diseases
    299954 (Ndufb9)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    299954 (Ndufb9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    299954 (Ndufb9)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N
Other DBs
NCBI-GeneID: 299954
NCBI-ProteinID: NP_001120766
RGD: 1307114
Ensembl: ENSRNOG00000009364
UniProt: B2RYW3
Position
7
AA seq 179 aa
MAFCAPPAYLTHRQKVLRLYKRALRHLESWCVHRDKYRYLACLMRARFEEHKNEKDMMKA
TQLLRQAEEEFWQNQHPQPYIFPDSPGGTSYERYECYKVPEWCLDYWHPSEKAVYPDYFS
KREQWKKLRMESWDREVKQLEEETSPDGIMTEALPPARKEGDLPPLWWHIVTRPRERPT
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgttctgtgctcccccggcctacttaacccaccggcagaaggtgctgcggctgtat
aagcgcgcgctgcgccacctcgagtcatggtgtgtccacagggacaaataccggtacctt
gcttgcttgatgagagcccggtttgaagaacataagaatgagaaggacatgatgaaggcc
acccagctgctgaggcaggcggaagaagaattctggcaaaaccagcatcctcagccgtat
atcttcccagactctcctgggggtacttcctatgagagatacgagtgctacaaggttcca
gaatggtgcttagattactggcatccttctgagaaagcagtgtatcctgattacttttcc
aagagagagcagtggaagaaactgaggatggagagctgggatcgggaggttaaacagctg
gaggaagaaacgtcacctgatggtattatgactgaagctttgcctcctgccagaaaggaa
ggcgacttgcccccattgtggtggcatattgtgaccagacctcgggaacggcccacatag

KEGG   Rattus norvegicus (rat): 301123
Entry
301123            CDS       T01003                                 

Gene name
Ndufa11
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
  KO
K03956  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    301123 (Ndufa11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    301123 (Ndufa11)
  09159 Environmental adaptation
   04714 Thermogenesis
    301123 (Ndufa11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    301123 (Ndufa11)
   05012 Parkinson disease
    301123 (Ndufa11)
   05014 Amyotrophic lateral sclerosis
    301123 (Ndufa11)
   05016 Huntington disease
    301123 (Ndufa11)
   05020 Prion disease
    301123 (Ndufa11)
   05022 Pathways of neurodegeneration - multiple diseases
    301123 (Ndufa11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    301123 (Ndufa11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301123 (Ndufa11)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 301123
NCBI-ProteinID: NP_997682
RGD: 1303292
Ensembl: ENSRNOG00000048320
UniProt: Q80W89
Position
9
AA seq 141 aa
MAKRFFEAYNETPDGTQCHRKAYITTALGGLCGLISSAYSITHNPADSPLEAVARVGRFT
FTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAIGCVYMGT
AAALFKMGKLEGWELFATPKV
NT seq 426 nt   +upstreamnt  +downstreamnt
atggccaagcggtttttcgaagcctacaatgagacccccgacggcacccagtgtcatcgc
aaggcctacatcactactgccttaggcggcctttgtggcctaataagctctgcttacagc
atcacacacaaccctgcagattctcccctggaagccgtggccagggtcggccggttcaca
ttcactgcagctgctattggagctatgtttggccttaccacctgtgtcagtgcccaggtc
cgagagaagccagatgaccccctgaactacttcattggaggttgtgcgggaggcctgaca
ctgggagcacgaactcacagctacgggaccgccgccattggctgtgtctacatgggtacc
gcggccgccctgttcaagatgggcaagctggagggctgggagctgtttgccacccccaag
gtgtga

KEGG   Rattus norvegicus (rat): 301427
Entry
301427            CDS       T01003                                 

Gene name
Ndufb3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
  KO
K03959  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    301427 (Ndufb3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    301427 (Ndufb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    301427 (Ndufb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    301427 (Ndufb3)
   05012 Parkinson disease
    301427 (Ndufb3)
   05014 Amyotrophic lateral sclerosis
    301427 (Ndufb3)
   05016 Huntington disease
    301427 (Ndufb3)
   05020 Prion disease
    301427 (Ndufb3)
   05022 Pathways of neurodegeneration - multiple diseases
    301427 (Ndufb3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    301427 (Ndufb3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301427 (Ndufb3)
SSDB
Motif
Pfam: NDUF_B12
Other DBs
NCBI-GeneID: 301427
NCBI-ProteinID: NP_001100382
RGD: 1310737
Ensembl: ENSRNOG00000011825
UniProt: D4A4P3
Position
9
AA seq 99 aa
MAAGHGHEHGHGHGKMELPDYRQWKIEGTPLEAMQKKLAARGLRDPWARNEAWRYMGGFA
DNITFTSVMLKGFKWGFAAFVVALGAEYFLTSHEDKKHH
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgctggacatggtcacgaacacggacatggtcatggtaaaatggaacttccagat
tacagacagtggaaaattgaagggacgccattagaagcaatgcagaagaagcttgctgca
cgagggctgagggatccatgggctcgcaatgaggcttggagatacatgggcggctttgca
gacaatatcaccttcacgagcgtaatgttaaaaggattcaaatgggggtttgctgcgttt
gtggtagctttaggggccgagtatttcctgacttcccatgaggataagaagcatcactga

KEGG   Rattus norvegicus (rat): 301458
Entry
301458            CDS       T01003                                 

Gene name
Ndufs1
Definition
(RefSeq) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor
  KO
K03934  NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    301458 (Ndufs1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    301458 (Ndufs1)
  09159 Environmental adaptation
   04714 Thermogenesis
    301458 (Ndufs1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    301458 (Ndufs1)
   05012 Parkinson disease
    301458 (Ndufs1)
   05014 Amyotrophic lateral sclerosis
    301458 (Ndufs1)
   05016 Huntington disease
    301458 (Ndufs1)
   05020 Prion disease
    301458 (Ndufs1)
   05022 Pathways of neurodegeneration - multiple diseases
    301458 (Ndufs1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    301458 (Ndufs1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301458 (Ndufs1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     301458 (Ndufs1)
SSDB
Motif
Pfam: Molybdopterin Fer2_4 NADH_dhqG_C NADH-G_4Fe-4S_3 Fer2
Other DBs
NCBI-GeneID: 301458
NCBI-ProteinID: NP_001005550
RGD: 1359670
Ensembl: ENSRNOG00000011849
UniProt: Q66HF1
Position
9
AA seq 727 aa
MLRIPVKRALIGLSKSPKGYVRSTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFEGKAVAAIAGGLVDAEALVALKDLLNK
VDSDTLCTEEIFPNEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGNHEFSKVLNAAKKPMVVLGSSA
LQRDDGAAILAAVSSIAQKIRVASGAAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKLLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLGEVSPNLVRYDDVE
EANYFQQASELAKLVDQEFLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgttaaggatacctgtaaaaagggccttgataggcctttctaagtctcctaaaggatat
gttcgatcaactggcacagcagcaagtaacttgattgaagtatttgttgatggtcagtct
gtcatggtggaaccaggaaccactgtcctgcaggcctgcgagaaggttggcatgcaaatc
cctcgattctgttaccatgaaaggttgtctgtagctggaaattgcaggatgtgcctggta
gagattgagaaagctccaaaggttgttgctgcttgtgctatgcctgttatgaagggctgg
aatatcctgacaaactcagaaaaatctaagaaagccagagaaggtgtgatggagttttta
ttagcaaatcacccattggattgtcctatttgtgaccagggaggtgaatgtgatctacag
gaccagtccatgatgtttggaagtgataggagccgatttctagaggggaagcgtgctgtg
gaggacaagaacattgggcccctggtaaagaccatcatgactagatgcatacagtgtacc
cgctgcatcaggtttgcaagtgaaattgcaggagtagatgatttgggaacaacggggaga
ggaaatgacatgcaagttggaacatacattgagaaaatgttcatgtctgaactgtctggg
aacatcattgatatctgccctgtcggggccctaacctctaagccttatgcctttactgcc
cggccttgggaaacaagaaagacagagtccattgatgtaatggatgcagtgggaagtaac
attgtggttagcacaagaactggagaggtaatgaggattttgccaagaatgcatgaagat
attaatgaagaatggatctctgataaaaccagatttgcctatgatggactgaaacggcaa
agacttaccgaaccaatggtcagaaatgaaaaggggcttttaacttatacctcctgggaa
gatgcactctctcgtgtagctggaatgttacagagttttgaaggcaaggctgtggcagca
attgcaggtggcttggtggatgctgaagccttggtagctctgaaagatttgcttaataaa
gttgactctgacaccttatgcactgaagagatcttccccaatgaaggagctggcacagat
ttacgttccaattatcttctcaataccacaattgccggtgtggaagaagcagatgttgtt
cttctagttggtacaaatccacgttttgaggcaccgctgtttaatgctagaatcagaaag
agctggctgcataatgacttaaaagtggccctaataggcagtccagtagacctcacttac
agatacgaccatctaggagactctcccaaaattctgcaagacattgcttcagggaatcat
gaattcagcaaggtcttaaacgcagctaaaaaaccaatggtggttttaggcagttctgca
ctccagagagatgatggggcagcaattcttgcagctgtgtccagcattgcacaaaagatt
cgggtggcaagtggtgctgctgcagagtggaaagttatgaatattctgcataggattgca
agccaggtagctgctttggaccttggctataaacctggggtagaagcaattaggaagaac
ccacccaaactgctgtttcttctgggagcagatggaggttgtatcacccggcaggacttg
ccaaaggattgtttcattgtttatcaaggacatcatggtgatgttggtgctcccatagct
gatgttattctcccaggggctgcttacacagaaaagtctgctacttacgtcaatactgag
ggcagagctcaacaaaccaaagtagcagtgacacctcctggcttggcaagagaagactgg
aaaatcataagagctctctctgagattgcaggtatcactctcccatatgatactctggat
caagtgagaaaccgtctcggagaagtctctcctaacctggttcgatatgatgatgttgaa
gaagctaattactttcaacaagcaagtgagcttgccaagctagtagaccaggaatttctt
gctgacccactggttccacctcagctaactataaaagacttctatatgacagattcaatt
agcagagcctcacagacaatggccaagtgtgtcaaagccgtcacagaaggcgctcaggca
gtagaggagccatccatatgctga

KEGG   Rattus norvegicus (rat): 315167
Entry
315167            CDS       T01003                                 

Gene name
Ndufa6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    315167 (Ndufa6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    315167 (Ndufa6)
  09159 Environmental adaptation
   04714 Thermogenesis
    315167 (Ndufa6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    315167 (Ndufa6)
   05012 Parkinson disease
    315167 (Ndufa6)
   05014 Amyotrophic lateral sclerosis
    315167 (Ndufa6)
   05016 Huntington disease
    315167 (Ndufa6)
   05020 Prion disease
    315167 (Ndufa6)
   05022 Pathways of neurodegeneration - multiple diseases
    315167 (Ndufa6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    315167 (Ndufa6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    315167 (Ndufa6)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 Herpes_gp2
Other DBs
NCBI-GeneID: 315167
NCBI-ProteinID: NP_001123977
RGD: 1309818
Ensembl: ENSRNOG00000008569
UniProt: D4A3V2
Position
7
AA seq 130 aa
MAAAASGLRQAASAASTSVKPIFSRDLKEAKRRVRELYRAWYREVPNTVHLMQLDITVKQ
GRDKVREMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRTHIMRFFHETETPRPKDF
LSKFYIGHDP
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcggccgcggccagcggcctgcgccaggctgcttctgcagccagtacctcggtgaag
cccattttcagtcgggacctgaaagaggccaagcggagggtgcgcgagctctaccgcgct
tggtaccgggaggtgccaaacactgtgcacttaatgcagctggatatcacggtgaaacaa
ggacgggataaagtccgagaaatgttcatgaagaatgcccatgtcaccgaccccagagtg
gttgacctcctggtcattaagggaaagatggagctccaggaaaccattaaagtgtggaag
cagcggacacacattatgcggttcttccatgaaacagaaacaccaaggccaaaagatttc
ttgtccaagttctatattggccatgacccatga

KEGG   Rattus norvegicus (rat): 316632
Entry
316632            CDS       T01003                                 

Gene name
Ndufa10l1
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 10-like
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    316632 (Ndufa10l1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    316632 (Ndufa10l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    316632 (Ndufa10l1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    316632 (Ndufa10l1)
   05012 Parkinson disease
    316632 (Ndufa10l1)
   05014 Amyotrophic lateral sclerosis
    316632 (Ndufa10l1)
   05016 Huntington disease
    316632 (Ndufa10l1)
   05020 Prion disease
    316632 (Ndufa10l1)
   05022 Pathways of neurodegeneration - multiple diseases
    316632 (Ndufa10l1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    316632 (Ndufa10l1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    316632 (Ndufa10l1)
SSDB
Motif
Pfam: dNK SKI Thymidylate_kin AAA_33 TsaE Cytidylate_kin2 Cytidylate_kin
Other DBs
NCBI-GeneID: 316632
NCBI-ProteinID: NP_872612
RGD: 1589745
Ensembl: ENSRNOG00000062245
UniProt: Q561S0 A0A1W2Q6F8
Position
6
AA seq 355 aa
MALRLLRLVPASASARGLAAGAQRVGRIHTSVHCKLRYGLLASILGDKTTKKLHEYSRVI
TVDGNICSGKNKLARDIAEQLGMKHYPEAGIQYSSSTTGDGRPLDIEFSGSCSLEKFYDD
PKSNDGNSYRLQSWLYASRLLQYSDALEHLLSTGQGVVLERSIYSDFVFLEAMYNRGFIR
KQCVDHYNEIKRLTLPEYLPSHAVIYIDVPVSEIQSRIQKKGDPHEMKVTSAYLQDIEDA
YKKTFLPQMSEICEVLMYSSWEAEDSTKVVEDIEYLNYNKGPWLKQDDRTFHNLRMLVQD
KREVLNYTTVPVYLPEITIGAHQGSRIYDSFRELPGRKYAPGYNADVGDKWIWLK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccttgaggttgctgagacttgtcccggcgtcggcgtccgcgcgcggcctcgcggcc
ggagcccagcgcgtgggacgaattcataccagtgtgcactgcaagctgaggtacgggctt
ttggcttccattctcggtgataagacaaccaaaaagctgcatgagtacagccgagtgata
acagtagatggcaacatatgctctgggaaaaacaagctcgcaagggacatcgcagagcag
ctaggcatgaagcactatccggaagcagggatacagtactcaagcagcaccacgggtgac
ggaaggcccctcgacatagagtttagtggcagctgtagtttagagaaattttatgacgat
cccaaaagcaacgacggcaacagctaccgcctacagtcctggctttatgccagccgcctc
ctgcagtactcagacgccctggagcacctcttgagcacaggacaaggtgtggtcttggag
cgttccatctacagtgactttgtcttcctggaggcaatgtacaaccggggcttcatccga
aagcagtgtgtggaccactataatgaaattaagcggcttactcttccagagtacctgcca
tcacatgcagtcatctatatcgatgtgcctgtgtcagaaatacagagcaggatccagaag
aaaggagatccacatgaaatgaaggtcacctctgcctatctccaggacatcgaggatgcc
tacaagaaaaccttcctcccacaaatgagtgagatatgcgaggtgttgatgtacagttcc
tgggaagctgaagactcaaccaaggtggtagaggacattgagtaccttaactacaacaaa
ggaccttggcttaaacaggatgatcggacctttcacaacctgcgaatgctggtccaggat
aagagagaagtgctgaattacacgactgtcccggtttacctcccagaaatcactattgga
gctcatcagggtagccggatctacgacagcttcagagagctgccaggccgcaagtacgcc
cctgggtacaatgccgatgtgggtgacaagtggatctggctgaagtga

KEGG   Rattus norvegicus (rat): 361385
Entry
361385            CDS       T01003                                 

Gene name
Ndufb7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    361385 (Ndufb7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    361385 (Ndufb7)
  09159 Environmental adaptation
   04714 Thermogenesis
    361385 (Ndufb7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    361385 (Ndufb7)
   05012 Parkinson disease
    361385 (Ndufb7)
   05014 Amyotrophic lateral sclerosis
    361385 (Ndufb7)
   05016 Huntington disease
    361385 (Ndufb7)
   05020 Prion disease
    361385 (Ndufb7)
   05022 Pathways of neurodegeneration - multiple diseases
    361385 (Ndufb7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    361385 (Ndufb7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    361385 (Ndufb7)
SSDB
Motif
Pfam: NDUF_B7 Cmc1
Other DBs
NCBI-GeneID: 361385
NCBI-ProteinID: NP_001101912
RGD: 1308550
Ensembl: ENSRNOG00000028717
UniProt: D3ZLT1
Position
19
AA seq 137 aa
MGAHLTRRYLWDASVEPDPEKMPSFPPNYGLPERKERVMVATQQEMMDAQLTLQQRDYCA
HYLIRLLKCKRDSFPNFVACKHEQHDWDYCEHQDYVKRMKEFERERRLLRRKKRRELREQ
RVAQGQGEGEVGPEMAL
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggggcgcacctgacccggcgctatctgtgggatgcctcggtggagcctgaccctgag
aagatgcccagcttcccgccgaactacggtcttccggagcgcaaggagcgagtgatggtg
gccacacagcaggagatgatggatgcccagctgacactacagcaacgtgactactgtgcg
cactacctcatccggctgctgaagtgcaaacgcgacagctttcccaacttcgtggcctgc
aagcatgagcagcatgactgggactactgcgagcaccaggactatgtgaagcgcatgaag
gagtttgaacgtgagcggcgactgctccgaaggaagaagcggagggaactgagggagcaa
cgggtagcccaaggccagggagaaggagaggtgggccctgagatggccctgtag

KEGG   Rattus norvegicus (rat): 362344
Entry
362344            CDS       T01003                                 

Gene name
Ndufb2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362344 (Ndufb2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    362344 (Ndufb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    362344 (Ndufb2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362344 (Ndufb2)
   05012 Parkinson disease
    362344 (Ndufb2)
   05014 Amyotrophic lateral sclerosis
    362344 (Ndufb2)
   05016 Huntington disease
    362344 (Ndufb2)
   05020 Prion disease
    362344 (Ndufb2)
   05022 Pathways of neurodegeneration - multiple diseases
    362344 (Ndufb2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    362344 (Ndufb2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362344 (Ndufb2)
SSDB
Motif
Pfam: NADH_B2
Other DBs
NCBI-GeneID: 362344
NCBI-ProteinID: NP_001102094
RGD: 1308130
Ensembl: ENSRNOG00000026616
UniProt: B2RYU0
Position
4
AA seq 105 aa
MSALARLAPFGRVGGRLLRGCRARAAGDGGVRHVGDGGHIQPRYREFPQLTQSQVIHGEV
LSSLMWFWILWRFWHDSDAVLGHFSYPDPSKWTDEELGVPPDDED
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtctgcgctggcccgcctggcacctttcggtcgcgttggaggccgcctgcttcggggc
tgccgcgcgcgggcagctggagacggtggagtccgtcatgttggcgatggtggacacatt
cagccccggtacagggagtttccccagcttacccagtcccaggtgatccatggtgaggtc
ttaagctcactcatgtggttctggattctttggagattttggcatgactcggatgctgtg
ctgggtcacttttcatatccagatccatcgaagtggacagatgaagaactgggggtccct
cctgacgacgaggactga

KEGG   Rattus norvegicus (rat): 362440
Entry
362440            CDS       T01003                                 

Gene name
Ndufa9
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362440 (Ndufa9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    362440 (Ndufa9)
  09159 Environmental adaptation
   04714 Thermogenesis
    362440 (Ndufa9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362440 (Ndufa9)
   05012 Parkinson disease
    362440 (Ndufa9)
   05014 Amyotrophic lateral sclerosis
    362440 (Ndufa9)
   05016 Huntington disease
    362440 (Ndufa9)
   05020 Prion disease
    362440 (Ndufa9)
   05022 Pathways of neurodegeneration - multiple diseases
    362440 (Ndufa9)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    362440 (Ndufa9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362440 (Ndufa9)
SSDB
Motif
Pfam: NmrA 3Beta_HSD NAD_binding_10 Epimerase RmlD_sub_bind GDP_Man_Dehyd NAD_binding_4 adh_short
Other DBs
NCBI-GeneID: 362440
NCBI-ProteinID: NP_001094222
RGD: 1307307
Ensembl: ENSRNOG00000061684
UniProt: Q5BK63
Position
4
AA seq 377 aa
MAAAVRFQVVRALPMSRPAISAAATSVFCSSSHRQLHHAVIPHGKGGRSSVSGVVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGDLGQLIFLEWDARDKDSIRKAV
QHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKEAGVERFIHVSHLNASMKSSAKS
LRSKAVGEKEVRTVFPDAIIIRPSDMFGREDRFLNHFANYRWFLAVPLVSLGFKTVKQPV
YVADVSKGIANATKNPDAIGKTFAFTGPNRYLLFHLVKYIFGMTHRTFIPYPLPRFVYSW
IGRLFGLSPFEPWTTKDKVERIHISDVMATDLPGLEDLGVQPTPLELKSIEVLRRHRTYR
WLSSEIEETKPAKTVNY
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggccgccgtccgctttcaggttgttagagcgcttccaatgtcacgtcctgccatt
tctgcagcagccacatctgtgttctgcagctcatcccatcgccagcttcaccatgctgtc
atacctcatgggaaaggtggccgctcatccgtcagtggagttgtggccaccgtgttcgga
gcaacaggcttcctgggtcgatacgttgtcaaccatcttggacgaatggggtcacaagtg
atcataccatatcggtgcgatatatatgacaccatgcaccttcgtctaatgggtgacctg
ggccagcttatctttctggagtgggatgctcgagacaaggattctatcaggaaagcagtg
cagcacagcaatgtggtcatcaatctcattgggcgggagtgggagaccagaaactttgat
tttgaggatgtttttgtgaatattcctcgagcaatagctcaggcatccaaggaagctggg
gttgagagattcattcatgtctcacacttgaatgccagtatgaagagttctgctaagtca
ctgagaagcaaggcagtgggagagaaggaagtgagaactgtgtttcctgatgccatcatc
atacgaccatctgacatgttcggaagggaggacaggttcctcaaccactttgcaaattat
cgttggtttcttgctgtgcctctcgtttctttgggctttaagacagtgaaacaaccagta
tatgttgcagatgtttccaaagggattgctaacgcgactaaaaatccagatgccatagga
aaaacctttgccttcaccgggccaaatcggtacctgctcttccacttggtgaagtacatc
tttggcatgacccacaggaccttcatcccttaccccttgccacggtttgtgtatagctgg
attggcagactcttcgggctgagtccatttgagccctggacaacaaaggacaaggtggag
cggatacatatctcagatgtgatggcgaccgacctgcccggcctggaagatcttggcgtt
cagcccacaccactggagctcaagtccatcgaggtgctccggcgacatcgcacttaccgc
tggctgtcttctgagatcgaggaaaccaagcctgccaagacagtcaactattag

KEGG   Rattus norvegicus (rat): 362588
Entry
362588            CDS       T01003                                 

Gene name
Ndufs5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362588 (Ndufs5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    362588 (Ndufs5)
  09159 Environmental adaptation
   04714 Thermogenesis
    362588 (Ndufs5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362588 (Ndufs5)
   05012 Parkinson disease
    362588 (Ndufs5)
   05014 Amyotrophic lateral sclerosis
    362588 (Ndufs5)
   05016 Huntington disease
    362588 (Ndufs5)
   05020 Prion disease
    362588 (Ndufs5)
   05022 Pathways of neurodegeneration - multiple diseases
    362588 (Ndufs5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    362588 (Ndufs5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362588 (Ndufs5)
SSDB
Motif
Pfam: Ndufs5 Cmc1
Other DBs
NCBI-GeneID: 362588
NCBI-ProteinID: NP_001025223
RGD: 1311081
Ensembl: ENSRNOG00000026646
UniProt: B5DEL8
Position
5
AA seq 106 aa
MPFLDVQKRLGISLDRHFIFLSAEQPYKNAARCHAFEKEWIECAHGIGATRAKKECKIEY
EDFEECFLRFKTIRRMHEIKKQREKLMKEGKYTPPPHHLGKEEPRP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcctttccttgatgtgcagaaaaggctgggcattagcctagatcgacactttatattc
ctaagtgctgagcagccttacaagaatgccgctcgatgccacgcatttgaaaaggagtgg
atagaatgcgcacatgggatcggtgctacccgggctaaaaaagagtgcaagatagagtat
gaagactttgaagaatgctttcttcggttcaaaacgataaggcggatgcatgaaatcaag
aaacagcgggagaagctgatgaaagaggggaagtacacccctccgcctcaccatttgggc
aaggaggagcccaggccctga

KEGG   Rattus norvegicus (rat): 362837
Entry
362837            CDS       T01003                                 

Gene name
Ndufs7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362837 (Ndufs7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    362837 (Ndufs7)
  09159 Environmental adaptation
   04714 Thermogenesis
    362837 (Ndufs7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362837 (Ndufs7)
   05012 Parkinson disease
    362837 (Ndufs7)
   05014 Amyotrophic lateral sclerosis
    362837 (Ndufs7)
   05016 Huntington disease
    362837 (Ndufs7)
   05020 Prion disease
    362837 (Ndufs7)
   05022 Pathways of neurodegeneration - multiple diseases
    362837 (Ndufs7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    362837 (Ndufs7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362837 (Ndufs7)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     362837 (Ndufs7)
SSDB
Motif
Pfam: Oxidored_q6
Other DBs
NCBI-GeneID: 362837
NCBI-ProteinID: NP_001008525
RGD: 1310013
Ensembl: ENSRNOG00000024568
UniProt: Q5RJN0
Position
7
AA seq 218 aa
MAALAAPGLLSVRILGLRTGTVAQLRRAHQSVAATGSPSSTQSAVSKAGAGAVVPKPSHL
PRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPR
QADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVP
VDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcggcgctggcggctcctggcttgctctctgtacggatcctgggtctgcgcacaggc
acagtggctcagctgcgcagagcccaccagagtgtggcagccactgggagcccgagcagc
acacagtctgccgtgtccaaggctggagctggagccgtggtccctaagccctcccatctt
cccagaagccgggccgagtatgtagtgaccaagctggatgacctcatcaactgggcgcgc
cggagctccctgtggcctatgaccttcggcttggcgtgctgtgccgtggagatgatgcac
atggccgccccgcgctatgacatggaccgctttggtgtggtgttccgtgccagcccgcgc
caggctgacgtgatgatcgtagctggcacgctcactaacaagatggctccagcactccgc
aaggtgtacgaccagatgcccgaaccccggtatgtggtgtccatggggagctgtgccaat
ggcggtggctactaccactactcctactcggttgttcgtggctgtgaccgaattgtgcca
gtggacatctatgtgccaggctgcccgcccacggccgaggcgctgctctacggcatcttg
cagctgcagcggaagatcaaacgcgaacagaagctgaagatctggtaccgcaggtag

KEGG   Rattus norvegicus (rat): 363441
Entry
363441            CDS       T01003                                 

Gene name
Ndufa1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    363441 (Ndufa1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    363441 (Ndufa1)
  09159 Environmental adaptation
   04714 Thermogenesis
    363441 (Ndufa1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363441 (Ndufa1)
   05012 Parkinson disease
    363441 (Ndufa1)
   05014 Amyotrophic lateral sclerosis
    363441 (Ndufa1)
   05016 Huntington disease
    363441 (Ndufa1)
   05020 Prion disease
    363441 (Ndufa1)
   05022 Pathways of neurodegeneration - multiple diseases
    363441 (Ndufa1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    363441 (Ndufa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    363441 (Ndufa1)
SSDB
Motif
Pfam: MWFE
Other DBs
NCBI-GeneID: 363441
NCBI-ProteinID: NP_001102283
RGD: 1560955
Ensembl: ENSRNOG00000052226
Vega: OTTRNOG00000002022
UniProt: G3V9S6 B4F7B9
Position
X
AA seq 70 aa
MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVHYQWYLMERDRRISGVNRY
YVSKGLENID
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtggttcgagattctccctggcctcgccattatgggggtgtgcctggtcatccccggg
gtgtccactgcgtacatccacaagttcaccaacgggggcaaggaaaagagagttgctcga
gttcattaccaatggtatttgatggaacgcgatagacgcatctctggtgtcaatcgctac
tatgtgtccaagggcctggagaacattgactaa

KEGG   Rattus norvegicus (rat): 499529
Entry
499529            CDS       T01003                                 

Gene name
Ndufs4
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial precursor
  KO
K03937  NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    499529 (Ndufs4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    499529 (Ndufs4)
  09159 Environmental adaptation
   04714 Thermogenesis
    499529 (Ndufs4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    499529 (Ndufs4)
   05012 Parkinson disease
    499529 (Ndufs4)
   05014 Amyotrophic lateral sclerosis
    499529 (Ndufs4)
   05016 Huntington disease
    499529 (Ndufs4)
   05020 Prion disease
    499529 (Ndufs4)
   05022 Pathways of neurodegeneration - multiple diseases
    499529 (Ndufs4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    499529 (Ndufs4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    499529 (Ndufs4)
SSDB
Motif
Pfam: ETC_C1_NDUFA4 CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 499529
NCBI-ProteinID: NP_001020317
RGD: 1594380
Ensembl: ENSRNOG00000011383
UniProt: Q5XIF3
Position
2
AA seq 175 aa
MAAVSMSVSLRQALLRQRAVATAAVSVCRVPSRLLNTSTWKLADGQTRDTQLITVDEKLD
VTPLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP
LSNMVLTFSAKEDAVAFAEKHGWSYDVEGRKVPKPKSKSYGANFSWNKRTRVSTK
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcggcggtctcaatgtcagtgtcgctgagacaggcgttgttgaggcaaagggcagta
gctacagctgcggtttccgtctgcagagttccatccaggttgttgaacacatcgacatgg
aagctggcagacggccaaactcgggacacccagcttataacagttgatgagaaactggat
gttactcctctaactggtgttccagaagagcacatcaaaaccagaaaggtcagaatcttt
gttcctgctcgcaataacatgcagtctggagtaaacaacacgaagaaatggaagatggag
tttgataccagagagagatgggaaaatcctttgatgggttgggcatcaacggccgatccc
ctctccaacatggttctcaccttcagtgccaaagaagatgcggttgcctttgcagaaaag
catggatggagctatgacgtggaagggaggaaggttccgaaacccaagtccaagtcttac
ggtgcaaacttttcttggaacaaaagaacaagagtgtctacaaaatag

KEGG   Rattus norvegicus (rat): 64539
Entry
64539             CDS       T01003                                 

Gene name
Ndufv3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial isoform 2
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    64539 (Ndufv3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    64539 (Ndufv3)
  09159 Environmental adaptation
   04714 Thermogenesis
    64539 (Ndufv3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64539 (Ndufv3)
   05012 Parkinson disease
    64539 (Ndufv3)
   05014 Amyotrophic lateral sclerosis
    64539 (Ndufv3)
   05016 Huntington disease
    64539 (Ndufv3)
   05020 Prion disease
    64539 (Ndufv3)
   05022 Pathways of neurodegeneration - multiple diseases
    64539 (Ndufv3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    64539 (Ndufv3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64539 (Ndufv3)
SSDB
Motif
Pfam: NDUFV3
Other DBs
NCBI-GeneID: 64539
NCBI-ProteinID: NP_001094481
RGD: 621020
Ensembl: ENSRNOG00000001182
UniProt: Q6PCU8
Position
20
AA seq 108 aa
MAVSLLLRGGRIRALKAALLEAKVFRGELASTVPLSTESENNKKAAGPTSKTESVFKEPT
LVPESSDTTTYKNLQHHEYNAFTFLDLNLDLSKFRLPQPSSGRESPRH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggtctctctcctgctgcggggaggacgaatccgggcgctgaaggctgcccttctc
gaggcaaaggtgttccgaggagaactggcttctacagtgcccctgtctacagagtccgag
aataataaaaaggcggcaggaccaactagcaagacggaaagtgtgttcaaagagcccaca
ctggttcccgagtcgagtgacaccaccacctacaagaacctgcagcatcatgagtacaac
gcattcaccttcctagacctgaacctggacctctccaagttcaggctgccacagccgtct
tcgggacgagagtcgccccggcactga

KEGG   Rattus norvegicus (rat): 678759
Entry
678759            CDS       T01003                                 

Gene name
Ndufa10
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial precursor
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    678759 (Ndufa10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    678759 (Ndufa10)
  09159 Environmental adaptation
   04714 Thermogenesis
    678759 (Ndufa10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    678759 (Ndufa10)
   05012 Parkinson disease
    678759 (Ndufa10)
   05014 Amyotrophic lateral sclerosis
    678759 (Ndufa10)
   05016 Huntington disease
    678759 (Ndufa10)
   05020 Prion disease
    678759 (Ndufa10)
   05022 Pathways of neurodegeneration - multiple diseases
    678759 (Ndufa10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    678759 (Ndufa10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    678759 (Ndufa10)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_33 Cytidylate_kin2 TsaE Cytidylate_kin
Other DBs
NCBI-GeneID: 678759
NCBI-ProteinID: NP_955789
RGD: 727968
Ensembl: ENSRNOG00000016470
UniProt: Q561S0 Q6P6W6
Position
9
AA seq 355 aa
MALRLLRLVPASASARGLAAGAQRVGRIHTSVHCKLRYGLLASILGDKTTKKLHEYSRVI
TVDGNICSGKNKLARDIAEQLGMKHYPEAGIQYSSSTTGDGRPLDIEFSGSCSLEKFYDN
PKSNDGNSYRLQSWLYASRLLQYSDALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGFIR
KQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVSEIQSRIQKKGDPHEMKVTSAYLQDIEDA
YKKTFLPKMSEICEVLVYSSWEAEDSTKVVEDIEYLNYNKGPWLKQDDRTFHNLRMLVQD
KREVLNYTTVPVYLPEITIGAHQGSRIYDSFRELPGRKYAPGYNADVGDKWIWLK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccttgaggttgctgagacttgtcccggcgtcggcgtccgcgcgcggcctcgcggcc
ggagcccagcgcgtgggacgaattcataccagtgtgcactgcaagctgaggtacgggctt
ttggcttccattctcggtgataagacaaccaaaaagctgcatgagtacagccgagtgata
acagtagatggcaacatatgctctgggaaaaacaagctcgcaagggacatcgcagagcag
ctaggcatgaagcactatccggaagcagggatacagtactcaagcagcaccacgggtgac
ggaaggcccctcgacatagagtttagtggcagctgtagtttagagaaattttatgacaat
cccaaaagcaacgacggcaacagctaccgcctacagtcctggctttatgccagccgcctc
ctgcagtactcagatgccctggagcacctcttgagcacaggacaaggtgtggtcttggag
cgttccatctacagtgactttgtcttcctggaggcaatgtacaaccagggcttcatccga
aagcagtgtgtggaccactataatgaaattaagcggcttactcttccagagtacctgcca
ccacatgcagtcatctatatcgatgtgcctgtgtcagaaatacagagcaggatccagaag
aaaggagatccacatgaaatgaaggtcacctctgcctatctccaagacatcgaggatgcc
tacaagaaaaccttcctcccaaaaatgagtgagatatgcgaggtgttggtgtacagttcc
tgggaagctgaagactcaaccaaggtggtagaggacattgagtaccttaactacaacaaa
ggaccttggcttaaacaggatgatcggacctttcacaacctgcggatgctggtccaggat
aagagagaagtgctgaattacacgaccgtcccggtttacctcccagaaatcactattgga
gctcatcagggtagccggatctacgacagcttcagagagctgccaggccgcaagtacgcc
cctgggtacaatgccgatgtgggtgacaagtggatctggctgaagtga

KEGG   Rattus norvegicus (rat): 679739
Entry
679739            CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    679739
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    679739
  09159 Environmental adaptation
   04714 Thermogenesis
    679739
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    679739
   05012 Parkinson disease
    679739
   05014 Amyotrophic lateral sclerosis
    679739
   05016 Huntington disease
    679739
   05020 Prion disease
    679739
   05022 Pathways of neurodegeneration - multiple diseases
    679739
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    679739
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    679739
SSDB
Motif
Pfam: zf-CHCC Thiolase_C
Other DBs
NCBI-GeneID: 679739
NCBI-ProteinID: XP_001053017
RGD: 1584802
Ensembl: ENSRNOG00000049394
Vega: OTTRNOG00000001218
UniProt: D3ZCZ9
Position
1
AA seq 116 aa
MAAALTFRRLLALPRAARGFGVRVSRSGEKITHTGQVYDEKDYRRIRFVDRQKEVNENFA
IDLIAQQPVNEVDHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQQHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcggcggcgctgaccttccgccggctgttggctctccctagggctgcccggggcttc
ggggtgcgagtgtcgcggagcggggagaagatcacgcataccggccaggtgtatgatgaa
aaagactacaggaggattcgttttgtagatcgtcagaaagaggtgaatgagaactttgcc
attgatttgatagcacaacaacctgtgaatgaggtggaccatcgtatcatagcctgtgat
ggagggggtggagccttgggccaccccaaggtgtatataaacctggacaaagaaacaaaa
acgggtacgtgtggctactgcggcctgcagttcaagcagcagcatcactag

KEGG   Rattus norvegicus (rat): 681024
Entry
681024            CDS       T01003                                 

Gene name
Ndufa4
Definition
(RefSeq) cytochrome c oxidase subunit NDUFA4
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    681024 (Ndufa4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    681024 (Ndufa4)
  09159 Environmental adaptation
   04714 Thermogenesis
    681024 (Ndufa4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    681024 (Ndufa4)
   05012 Parkinson disease
    681024 (Ndufa4)
   05014 Amyotrophic lateral sclerosis
    681024 (Ndufa4)
   05016 Huntington disease
    681024 (Ndufa4)
   05020 Prion disease
    681024 (Ndufa4)
   05022 Pathways of neurodegeneration - multiple diseases
    681024 (Ndufa4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    681024 (Ndufa4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    681024 (Ndufa4)
SSDB
Motif
Pfam: B12D
Other DBs
NCBI-GeneID: 681024
NCBI-ProteinID: NP_001121156
RGD: 1584719
Ensembl: ENSRNOG00000005512
UniProt: B2RZD6
Position
4
AA seq 82 aa
MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPN
EQYKFYSVNVDYSKLKKEGPDF
NT seq 249 nt   +upstreamnt  +downstreamnt
atgctccgccagatcctcgggcaagccaagaaacatcccagcttgatccctctcttcgtg
tttattggagcagggggtactggagcagcactgtatgtgatgcgcttggcattgttcaat
ccagatgtcagctgggacaggaagaataacccagagccttggaacaaactgggtcccaat
gaacaatataagttctattctgtgaacgtggactacagcaaactgaaaaaagaaggccca
gacttctaa

KEGG   Rattus norvegicus (rat): 681418
Entry
681418            CDS       T01003                                 

Gene name
Ndufb10
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    681418 (Ndufb10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    681418 (Ndufb10)
  09159 Environmental adaptation
   04714 Thermogenesis
    681418 (Ndufb10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    681418 (Ndufb10)
   05012 Parkinson disease
    681418 (Ndufb10)
   05014 Amyotrophic lateral sclerosis
    681418 (Ndufb10)
   05016 Huntington disease
    681418 (Ndufb10)
   05020 Prion disease
    681418 (Ndufb10)
   05022 Pathways of neurodegeneration - multiple diseases
    681418 (Ndufb10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    681418 (Ndufb10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    681418 (Ndufb10)
SSDB
Motif
Pfam: NDUFB10
Other DBs
NCBI-GeneID: 681418
NCBI-ProteinID: NP_001102913
RGD: 1310782
Ensembl: ENSRNOG00000014568
UniProt: D4A0T0
Position
10
AA seq 176 aa
MPDSWDKDVYPEPPRRTPAPSPQTSIPNPITYLTKAYDLVVDWPVTLVREFIEQQHAKNR
TYYYHRQYRRVPDITECKEGDVICIYEAEMQWRRDFKVDQEIINIIQERLKACQQREGES
ALQNCAKELEQFTQVSKAYQDRYQDLGAYYSARKCLAKQKQRMLEERKAAKETAAA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgccggactcttgggacaaggatgtgtacccggagcccccgcgccgcacgcctgctccc
tcgccgcagacctcgatccctaaccccatcacctacttgacgaaggcctacgacctcgtc
gtggactggcccgtgaccctcgtgagagagttcattgaacaacagcacgccaagaaccga
acctactactaccaccgacagtaccgtcgagtgccagacatcacggaatgcaaagagggt
gatgtcatctgtatctatgaggctgagatgcagtggagaagggacttcaaagtggaccaa
gaaatcatcaacatcatccaggagagacttaaggcttgtcagcagagggaaggagagagt
gcactgcagaactgtgccaaggaattggagcaattcacccaagtgtctaaagcctaccag
gaccgctaccaggacctgggagcctactattctgccaggaagtgcctggcaaagcagaag
cagaggatgctggaagagagaaaggctgccaaggagactgctgccgcctaa

KEGG   Rattus norvegicus (rat): 684509
Entry
684509            CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    684509
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    684509
  09159 Environmental adaptation
   04714 Thermogenesis
    684509
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    684509
   05012 Parkinson disease
    684509
   05014 Amyotrophic lateral sclerosis
    684509
   05016 Huntington disease
    684509
   05020 Prion disease
    684509
   05022 Pathways of neurodegeneration - multiple diseases
    684509
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    684509
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    684509
SSDB
Motif
Pfam: NADHdh_A3
Other DBs
NCBI-GeneID: 684509
NCBI-ProteinID: XP_003749429
RGD: 1589176
Ensembl: ENSRNOG00000050514
UniProt: M0RB63
Position
2
AA seq 84 aa
MAARISAFLKNAWAKEPVLVVSFTVWGLAVIMPMISPYTKYASMINKATPYNYPVPVRDN
GNMPDVPSHPQEPLGPSLEWIKNL
NT seq 255 nt   +upstreamnt  +downstreamnt
atggctgctagaatctccgccttccttaagaatgcctgggcaaaggagccggtgctggtg
gtgtccttcactgtctggggcctcgctgtaattatgcccatgattagcccctacaccaag
tatgctagcatgatcaacaaggccacaccctacaactacccagtgcctgtgagagataat
gggaacatgcctgatgtgcccagccacccacaggaacctctgggcccaagcttggaatgg
atcaagaacctgtga

KEGG   Rattus norvegicus (rat): 689938
Entry
689938            CDS       T01003                                 

Gene name
Ndufc1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
  KO
K03967  NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    689938 (Ndufc1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    689938 (Ndufc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    689938 (Ndufc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    689938 (Ndufc1)
   05012 Parkinson disease
    689938 (Ndufc1)
   05014 Amyotrophic lateral sclerosis
    689938 (Ndufc1)
   05016 Huntington disease
    689938 (Ndufc1)
   05020 Prion disease
    689938 (Ndufc1)
   05022 Pathways of neurodegeneration - multiple diseases
    689938 (Ndufc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    689938 (Ndufc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    689938 (Ndufc1)
SSDB
Motif
Pfam: NADH_dh_m_C1
Other DBs
NCBI-GeneID: 689938
NCBI-ProteinID: XP_003749323
RGD: 1586362
Ensembl: ENSRNOG00000038218
UniProt: D3ZS75
Position
2
AA seq 76 aa
MAPPVVLRSFSRLLAPARLPSCSSTRSKFYVREPVNAKPNWVKVGLTLGTSIFMWIYLIH
QHNEDVLEYKRRNGLE
NT seq 231 nt   +upstreamnt  +downstreamnt
atggcgccgcccgtagtactgcgctcgttttcgcggctgctggcccccgccaggctgccg
agctgctcttcaacacggtcaaagttctatgtccgggagccagtcaatgccaaacctaac
tgggtgaaagttgggctgaccttgggcacctcgattttcatgtggatttatctcatccac
caacacaacgaagatgttttggagtataaaagaagaaatggactggaataa

KEGG   Rattus norvegicus (rat): 691001
Entry
691001            CDS       T01003                                 

Gene name
Ndufa3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    691001 (Ndufa3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    691001 (Ndufa3)
  09159 Environmental adaptation
   04714 Thermogenesis
    691001 (Ndufa3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    691001 (Ndufa3)
   05012 Parkinson disease
    691001 (Ndufa3)
   05014 Amyotrophic lateral sclerosis
    691001 (Ndufa3)
   05016 Huntington disease
    691001 (Ndufa3)
   05020 Prion disease
    691001 (Ndufa3)
   05022 Pathways of neurodegeneration - multiple diseases
    691001 (Ndufa3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    691001 (Ndufa3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    691001 (Ndufa3)
SSDB
Motif
Pfam: NADHdh_A3
Other DBs
NCBI-GeneID: 691001
NCBI-ProteinID: XP_001076462
RGD: 1588687
Ensembl: ENSRNOG00000060293
Position
1
AA seq 103 aa
MQGKEPQLPESSLLLSKTKMAARISAFLKNAWAKEPVLVVSFTVWGLAIIMPMISPYTQY
ASMINKATPYNYPVPVRDNGNMPDVPSHPQEPLGPSLEWLKNL
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcaaggaaaagaaccacaactcccagagagctccctgctcttgtccaagaccaagatg
gctgctagaatctccgccttccttaagaatgcctgggcaaaggagccggtgctggtggtg
tccttcactgtctggggcctcgctataattatgcccatgattagcccctacacccagtat
gctagcatgatcaacaaggccacaccctacaactacccagtgcctgtgagagataatggg
aacatgcctgatgtgcccagccacccacaggaacctctgggtccaagcttggaatggctc
aagaacctgtga

KEGG   Rattus norvegicus (rat): 81728
Entry
81728             CDS       T01003                                 

Gene name
Ndufv2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    81728 (Ndufv2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    81728 (Ndufv2)
  09159 Environmental adaptation
   04714 Thermogenesis
    81728 (Ndufv2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81728 (Ndufv2)
   05012 Parkinson disease
    81728 (Ndufv2)
   05014 Amyotrophic lateral sclerosis
    81728 (Ndufv2)
   05016 Huntington disease
    81728 (Ndufv2)
   05020 Prion disease
    81728 (Ndufv2)
   05022 Pathways of neurodegeneration - multiple diseases
    81728 (Ndufv2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    81728 (Ndufv2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    81728 (Ndufv2)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     81728 (Ndufv2)
SSDB
Motif
Pfam: 2Fe-2S_thioredx
Other DBs
NCBI-GeneID: 81728
NCBI-ProteinID: NP_112326
RGD: 621733
Ensembl: ENSRNOG00000042503
UniProt: P19234
Position
9
AA seq 248 aa
MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYE
RIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTM
YNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACV
NAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGP
GFGVQAGL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttctccttggcgctgcgggccagggcgtccggcctcaccgctcagtggggaagacat
gcaaggaatttgcataagacagcagtgcaaaatggtgctggaggagccttatttgtgcat
agagatactcctgagaataacccagatactccatttgatttcacaccagaaaactacgag
aggatagaggcaatagtcagaaactacccggaagggcacagagcagcagctgtgcttcca
gtgctggacctggcccaaaggcagaatgggtggctgcctatctctgccatgaacaaggtg
gcagaagttttacaagtgcctccaatgagagtctatgaagtggcgactttttacacaatg
tacaatcgaaagccagttgggaagtaccacattcaggtctgcactactacaccttgcatg
cttcgagactctgacagcatcctggagacccttcagagaaagctgggaataaaagttgga
gagactacgcctgacaagcttttcactcttatagaagtagaatgtttaggggcctgtgta
aacgcaccgatggttcaaataaacgacgactactacgaggatctgacacccaaggatatt
gaagagattattgatgaactcagagctgggaaagttccaaaaccagggccaaggagtggc
cgcttctgttgtgagccagccggaggccttacttctttgactgaaccacccaaaggacct
ggctttggtgtgcaagcaggcctttaa

DBGET integrated database retrieval system