KEGG   Rattus norvegicus (rat): 100362547
Entry
100362547         CDS       T01003                                 

Gene name
Ap1g2
Definition
(RefSeq) AP-1 complex subunit gamma-like 2 isoform X1
  KO
K12391  AP-1 complex subunit gamma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100362547 (Ap1g2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100362547 (Ap1g2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100362547 (Ap1g2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    100362547 (Ap1g2)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 Kinetochor_Ybp2 DUF5609
Other DBs
NCBI-GeneID: 100362547
NCBI-ProteinID: XP_002728326
RGD: 2324507
Ensembl: ENSRNOG00000025619
UniProt: D3ZGW2
Position
15
AA seq 785 aa
MVPSLKLQDLIEEIRGAKTQAQEREVIQKECAQIRASFRDGDPLQRHRQLAKLLYVHMLG
YPAHFGQMECLKLIASPRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQG
LALCTLSTMGSAEMCRDLATEVEKLFQQPSPYVRKKAILAAVHMIRKDPELSNIFLPPCT
KLLRERHHGTLLGTITLITELCERNPAALRHFRKVVPQLVQILRTLVTTGYSTEHSISGV
SDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLLETVLTIMAIH
SAAGLRVLAVNILGRFLLNNDKNIRYVALTSLLQLVQSDHSAVQRHRSTVVECLQEKDAS
LSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPSKRWHID
TILHVLTTAGTHVRDDAVANLTQLIGEAEELHTYSVRRLYSALAEDISQQPLVQVAAWCI
GEYGDLLLEGNCEETEPFQVEEEDVLALLEKVLQSHMSLPATRGYAITALMKLSTRLQGD
NNRIRQVVSIYGSCMDIELQQRAVEYNVLFQKYDHMRAAILEKMPLVERSDPQVNEEGKE
KQTGAQPLEATAPVPTQPQATKLLDLLDLLDDTSGHAQRLPPLDPSPGEALINLLDLPCA
PPTPAPIPSVRVFERKGLQLDLSFMRPSETPALLLVTATTTNSSEEAVTHFVCQAAVPKS
FQLQLQAPSGNTIPAQGGPPITQVFRILNPNKAPLRLKLRLTYNHSGQPVQEIFEVDNLP
VETWQ
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggtgccttcgttgaaacttcaggacctaatcgaagagattcgtggggccaagacgcag
gcccaggaacgggaggtgatccagaaggagtgcgcccaaattcgggcctccttccgcgat
ggggatcccctgcagagacatcgccagctagccaaacttctctacgtccatatgttgggc
taccccgcccactttggacagatggagtgcctgaaactgatcgcctcccccagattcaca
gacaagagggtgggctaccttggggccatgctcctattggatgagagacacgatgcccat
ctgctcattaccaacagcatcaagaatgacctgagccaagggattcagccagttcaaggc
ctggccctgtgtactctgagtaccatgggctctgctgagatgtgccgggacctagccacc
gaggtggaaaagctgtttcagcaacccagcccctatgtgcgtaagaaggctatcttggct
gcagtgcacatgatccggaaggaccccgagctctccaacatcttcctcccaccctgtacc
aaactgcttcgtgagcgccatcatggcaccctgctgggcaccatcacgctgatcacggag
ctctgtgaaagaaaccctgcagccctcagacactttcgcaaggtagtgccccagctggta
cagatcctccggactctggtgacgacaggatactccacagagcacagtatctctggagtc
agcgaccccttcttgcaggtccagatactccgcctacttcggatcctcggacggaaccat
gaagaaagcagcgagaccatgaacgacttgctggcccaggtagccaccaacacagacacc
agccgaaatgcaggcaacgcagtcctgttggagacagtactgaccatcatggccatccac
tctgcagctggcctccgggttctagctgttaacattctcggtcgtttcttgctcaacaat
gacaagaatatcaggtatgtagctctgacatcgttgctgcagctggtacagtctgaccac
agtgctgtgcaacgtcaccggtccaccgtggtagagtgtctacaggaaaaggacgcctcc
cttagcaggcgggccctggagctgagcctggccctggtgaatagctccaatgtgcgagct
atgatgcaggagctgcaggcctttctggagtcctgcccccctgatcttcgggctgactgt
gcctcaggcattctgttggctgcagagaggtttgctcccagcaagcggtggcacatagac
accattctgcacgtgctgaccacggcaggcacccatgtgagggatgatgcagtggccaac
ttgacccagctgattggggaggccgaggagctgcatacctactccgtgcgccgcctctac
agtgcgttagcagaggatatctcccagcaaccactggttcaggtggcggcctggtgtatt
ggcgagtatggagacctcctgctggaaggtaactgtgaggagacggagccttttcaggtg
gaagaagaggacgtgctggcactactggagaaggtgctccagtcccacatgtccctgcca
gccactcgaggctatgctatcacggctctcatgaaactcagcacccggctccagggagac
aacaatcgtatccgccaggtggtgtccatctacgggagctgtatggacatagagcttcaa
cagcgggctgtggagtataacgtactcttccagaagtatgaccacatgagggctgccatc
ctcgaaaagatgcctcttgtggagcgcagtgaccctcaagttaatgaggaagggaaggaa
aagcaaactggggcccagcccttggaagcaacagcccctgtccccacacaaccccaggcc
accaaactcttagatctgcttgatctcctggatgacacttctgggcatgctcagcgcctt
cctcctctggacccttccccaggggaagccttaattaatctcctcgaccttccctgtgca
cctccaaccccagctccaatccccagtgtcagagtgtttgagcgtaagggcctacagctg
gatctttccttcatgcggccctcggaaacccctgctttgctcttagtcactgccaccacc
accaactcctcagaggaggctgttacccacttcgtttgccaggcggctgtgcccaagagt
ttccagctgcagttacaggcccccagtgggaacacaattccagctcagggtggtcctccc
atcacccaggtcttcagaatcctcaatcctaacaaggcccctttgcgactaaagcttcgc
ctcacctacaaccactctggccagccagtgcaggagatcttcgaggtggacaacttgcct
gtggagacgtggcagtaa

KEGG   Rattus norvegicus (rat): 171494
Entry
171494            CDS       T01003                                 

Gene name
Ap1g1
Definition
(RefSeq) AP-1 complex subunit gamma-1
  KO
K12391  AP-1 complex subunit gamma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171494 (Ap1g1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    171494 (Ap1g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171494 (Ap1g1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    171494 (Ap1g1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 DUF5609 Katanin_con80
Other DBs
NCBI-GeneID: 171494
NCBI-ProteinID: NP_604455
RGD: 619785
UniProt: B2RYN6
Position
19
AA seq 822 aa
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLG
YPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQG
LALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATK
NLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGI
SDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIK
SESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVS
IKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGVFLAAEKYAPSKRWHID
TIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCI
GEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCT
VNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPSEIVQ
TNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPASAGGELLDLL
GDITLTGAPAAAPTPASVPQITQPPFLLDGLSSQPLFNDIAPGIPSITAYSKNGLKIEFT
FERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQ
VIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgccagcccccatcagattgcgggagctgatccggaccatccggacagcccgaacccaa
gctgaggaacgagaaatgatccagaaagaatgtgctgcgatccggtcatcattcagagaa
gaagacaatacataccggtgtcggaatgtggcaaagttactatatatgcacatgctgggc
taccctgctcactttggacagttggagtgcctcaagctaatcgcctcacaaaagttcaca
gacaaacgcattggctatttaggagcaatgctgttattagatgaaagacaagacgtacat
cttctcatgaccaattgtatcaagaatgatcttaatcatagcacgcagtttgtgcaggga
ctagcactttgtacccttggctgcatgggctcctcagagatgtgcagagatcttgcagga
gaggtagagaagcttctgaaaacctccaactcttacttaagaaaaaaggcagcactgtgt
gctgttcacgtcatcaggaaggttcctgaacttatggagatgtttttaccagcaacaaaa
aatttattgaatgagaagaaccatggtgtccttcacacgtctgtagtcctcctcacagag
atgtgtgaacggagcccagacatgctcgcacatttcagaaagcttgtgccccaattagtt
cgtattctaaagaacctcatcatgtccggatattccccagaacatgatgtttctggtatc
agtgacccctttttgcaggtacgaattttgcggttattaagaattttaggacggaatgat
gatgattcaagcgaagctatgaatgatatattagcacaggtcgccactaatacagagacc
agtaagaatgtagggaatgctattctgtatgaaacggttttgactatcatggatattaaa
tcagagagtggattgcgtgttctagccataaatattcttggtcgattcttattgaacaat
gacaaaaatattagatatgttgctctgacatctctgttgaagactgtgcagacagatcat
aatgctgtacagaggcatagaagcacaattgtggactgtctaaaagatctggatgtctcc
ataaaaagacgtgcaatggaattgagttttgccctggtgaatgggaataatatccgaggc
atgatgaaggagttactttattttctggattcttgtgaaccagaatttaaagcggattgt
gcatctggagtcttccttgctgcagaaaagtacgcaccttccaaacggtggcatatagat
acaattatgcgtgtcttgacaacggcaggaagttatgttcgtgatgatgcagttcccaac
ttgattcagttaataaccaacagtgtggagatgcacgcttacaccgtccagcgcctgtac
aaggcaattctcggtgattattctcaacaacccttggtacaggtggccgcatggtgtata
ggtgaatatggtgatctccttgtgtctggccagtgtgaagaggaagagcctattcaggtg
acagaagatgaagtgctggatattttagaaagtgtcctgatctctaatatgtctacctct
gtgacaagaggttatgctctcactgccattatgaagctgtctactcgattcacctgtact
gtaaaccgaattaagaaagtagtttccatctatggaagcagcatcgacgtagagctccaa
cagagggcagtagaatacaatgcactttttaagaagtatgaccacatgaggtctgcccta
cttgaaagaatgcctgtcatggaaaaagtgaccacaaatggcccttctgagattgtgcag
acaaatggagagacagaaccagctccactagagactaaaccaccaccctctgggccacaa
cccacgagccaggccaatgatctattggacctgttgggaggaaatgacataacacctgtt
attccaactgcacctacaagcaaaccagcgtctgctggtggggagcttcttgacttgctg
ggagacatcaccctaacaggtgctccagctgctgctcccacccctgcctcagtgccacag
ataacccagcccccattcttgttggatgggctttcgtcacagcctctcttcaatgacatc
gctccaggcatcccctccatcacagcgtacagtaagaacggcttgaagatagaattcacc
tttgagcggtcaaacaccaaccccagtgtaacagtgataacgatacaggcctctaacagc
acagagctagacatgacggactttgttttccaggctgcagtaccaaagacattccagctg
cagcttctgtctcctagcagcagcgtcgtcccagcctttaatacagggaccatcacacaa
gtcattaaagttctgaacccacagaagcaacagctgcgaatgcggatcaagctcacatac
aatcacaagggctcagcaatgcaggatctcgcagaagtgaacaatttcccccctcagtcc
tggcagtga

KEGG   Rattus norvegicus (rat): 29663
Entry
29663             CDS       T01003                                 

Gene name
Ap1b1
Definition
(RefSeq) AP-1 complex subunit beta-1
  KO
K12392  AP-1 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29663 (Ap1b1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29663 (Ap1b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29663 (Ap1b1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    29663 (Ap1b1)
SSDB
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Cnd3 Arm RTP1_C1 Arm_2 API5 Transposase_22 Sec7_N
Other DBs
NCBI-GeneID: 29663
NCBI-ProteinID: NP_001295227
RGD: 2064
Ensembl: ENSRNOG00000008786
UniProt: G3V9N8
Structure
PDB: 
1W63

Position
14
AA seq 949 aa
MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANA
VAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLLKKLAPPLVTLLSAEPELQY
VALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLDGFHDESTQV
QLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEV
VLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPNAFVEGGRGVVHKSLPPRTASS
ESTESPEAAPAGAPASDQPDVIPAQGDLLGDLLNLDLGPPVSGPPLAASSVQMGAVDLLG
GGLDSLMGDEPEGIGDSNFGAPPASVAAAAPARLGAPVSSGLSDLFDLTSGVGTLSGSYV
APKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAA
PLQVHAPLSPNQTVEISLPLNTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHVLFVE
DGKMDRQMFLATWKDIPNENEAQFQIRDCPLNTEAASSKLQSSNIFTVAKRTVEGQDMLY
QSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHVYQAYETILKN
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgactgactcaaaatacttcacaacaaccaagaaaggggagatcttcgagttgaaggca
gagcttaacagtgacaagaaggagaagaagaaggaggcagtaaagaaagtgattgcatca
atgaccgtgggcaaagatgtcagtgctctcttccctgatgtggtgaactgcatgcagaca
gacaacctggagctaaagaagctggtgtacctgtacttgatgaactatgccaagagtcag
cctgacatggccattatggctgtcaacaccttcgtgaaggactgtgaggaccccaacccc
cttatccgggccctggctgtgaggactatgggctgcatccgagttgacaagatcacagag
tacttgtgtgaaccactccggaaatgcctgaaggatgaagacccatatgtgcgcaagaca
gcagctgtgtgtgtagccaagctccacgacatcaacgcccagctggtagaggaccagggt
ttcctggacacactcaaagacctcatctctgactctaaccccatggtggtagcaaatgca
gtggctgccctgtcagagatcgctgagtctcaccccagtagcaacctgcttgacttgaac
ccacagtctatcaacaagctgctgacagcccttaatgagtgcaccgagtggggccagatc
ttcattctggactgtctggcgaactacatgcccaaggatgaccgtgaggcccagagcatc
tgcgagcgggtcactcctaggctttcccatgccaactctgctgtggtgctgtccgcagtg
aaggtcctgatgaagttcatggagatgctgtctaaggacctggactactatgccacacta
ctcaagaagctggcccctcccctggtcacactgctgtcagcagagccagagttgcagtat
gtggctctgcgcaatattaacctcattgtacagaaaaggccagagattttgaagcatgaa
atgaaggttttctttgtgaagtacaatgaccccatctatgtgaagctggagaaactggac
attatgatccgcctggcctcccaggccaacattgcccaggttttggcagaactcaaagag
tacgcgacagaagtagatgtggattttgtacggaaggcagtgcgtgccattggccgctgt
gccatcaaggtggagcaatctgcagagcgctgtgtgagcacattgcttgatctcatccag
accaaggtcaactatgtggtccaggaagccattgtggtcattaaagacatcttccgcaag
taccccaacaagtacgagagtgtgatagccacactgtgtgagaatctggactcgctggat
gagcctgaggctcgcgctgctatgatctggatagtgggcgagtatgctgagcggattgac
aatgcggacgagctgcttgagagcttcctcgacggcttccatgacgagagcacccaggtc
cagctacagctgctgacagccattgtgaagctcttcctgaagaagccaacagagacgcag
gagctggtgcagcaggtcctcagtttggccactcaggactcggacaatccagaccttcgg
gaccgtggctacatctactggcgcctgctctccacggaccctgtagctgccaaagaggtg
gtactggctgagaagcccctcatctcagaagagacagaccttattgagcccacactgctg
gatgaactcatctgctacattggcacactggcctctgtctaccacaagccacccaatgcc
tttgtggagggcggccggggagtggtgcacaagagtctgccacctcgcactgcctcgagc
gaaagcacagagagccctgaggcagcccctgccggagcacctgctagtgaccagcctgat
gtcattcctgcccagggtgacctgttaggtgacctcctcaacctggaccttgggccccca
gtgagtggcccacccttggctgcctcctcagtgcagatgggagctgtggatcttcttggt
ggtggcctcgacagcctgatgggggatgagcctgaagggattggagacagcaactttggg
gcacctccagcatcagtggcggcggcagcaccagccagacttggagcacccgtcagcagt
ggcttaagtgacctctttgacctgaccagtggagtgggcaccctctcagggtcctatgtc
gctcccaaagcagtttggctccctgccatgaaggccaaggggctggaaatctctggcacc
ttcacccggcaggttggctccatctccatggatctgcagctgactaacaaggccctgcag
gtcatgacagatttcgctatccagtttaatcggaacagctttggcttggcccccgctgcg
ccactccaagtgcacgccccactgagccccaaccagacggtggagatctccctgcctctt
aacacggtgggctcagtcatgaagatggagcctctgaacaatcttcaggtggctgtgaag
aacaacattgacgtcttctacttcagcactttgtacccactgcatgtcctcttcgtggag
gacgggaagatggaccggcagatgttcctggccacatggaaggacattcccaacgagaat
gaagcccagttccagatcagagactgcccgctgaacacagaggctgcaagcagcaagctg
caaagcagtaacattttcactgtcgccaagaggactgtggagggccaggacatgctctac
caatctctgaagttgaccaatggcatctgggtgctggcagagctgcggatccagccaggc
aaccccagtttcacgctgtccctgaagtgtcgagcgccagaggtgtcccagcatgtatac
caggcctacgagaccatcctcaagaactga

KEGG   Rattus norvegicus (rat): 302671
Entry
302671            CDS       T01003                                 

Gene name
Ap1s2
Definition
(RefSeq) AP-1 complex subunit sigma-2
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    302671 (Ap1s2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    302671 (Ap1s2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    302671 (Ap1s2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    302671 (Ap1s2)
SSDB
Motif
Pfam: Clat_adaptor_s PulA_N1
Other DBs
NCBI-GeneID: 302671
NCBI-ProteinID: NP_001121003
RGD: 1561862
Ensembl: ENSRNOG00000038686
UniProt: B2GV08
Position
X
AA seq 157 aa
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcagtttatgttgctttttagtcgtcagggaaagcttcgactgcagaaatggtatgtc
ccactgtcagacaaagagaagaagaaaatcaccagagaacttgtgcaaaccgttttagca
cggaaacccaagatgtgcagcttccttgagtggagagatctgaagattgtttataaaaga
tatgccagtctatatttttgctgtgctattgaggatcaggacaatgaactgattaccctg
gaaataatccatcgttatgtggaattacttgacaagtattttggcagtgtgtgtgaactt
gatatcatctttaattttgagaaggcctattttattttggatgaatttcttttgggagga
gaagttcaggaaacatcaaagaaaaatgtccttaaagcaattgagcaggctgatctcctg
caggaggaagctgaaaccccacgtagtgttcttgaagaaattggactgacataa

KEGG   Rattus norvegicus (rat): 306332
Entry
306332            CDS       T01003                                 

Gene name
Ap1m1
Definition
(RefSeq) AP-1 complex subunit mu-1
  KO
K12393  AP-1 complex subunit mu
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    306332 (Ap1m1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    306332 (Ap1m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    306332 (Ap1m1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    306332 (Ap1m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF5482
Other DBs
NCBI-GeneID: 306332
NCBI-ProteinID: NP_001037704
RGD: 1307653
Ensembl: ENSRNOG00000014454
UniProt: Q32Q06
Position
16
AA seq 423 aa
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtccgccagcgccgtctacgtactggacctgaagggcaaggtgctcatctgcaggaac
taccgtggggatgtggacatgtcagaggtggagcacttcatgcccattctgatggagaag
gaggaggagggcatgctgtcacctatcttggcccatggtggcgttcgtttcatgtggatt
aagcacaacaacctgtacctggtcgccacttcaaaaaagaatgcttgtgtgtcgctagta
ttctccttcctctacaaggtggtgcaggtgttctctgagtactttaaggagctggaggag
gagagcatccgagacaactttgttatcatttatgagcttctggatgagctcatggacttc
ggctacccgcagaccaccgacagcaagatcctgcaggagtacatcactcaggaaggccac
aagctggaaacaggagcccctcggcccccagccaccgtcaccaatgctgtgtcctggcgc
tcagaaggtatcaagtatcggaagaacgaagtattcctggacgtcattgaggccgttaac
ctcttggtcagtgccaatggcaacgtgctgcgtagtgagatcgtgggttccatcaagatg
cgcgtcttcctctcaggcatgcctgagctacgcctgggtctcaatgacaaagtcctcttc
gacaacacgggccgagggaagagcaagtcagtggagctggaggacgtgaagttccaccag
tgtgtgcggttgtcacgttttgagaatgaccgcacaatatccttcattccaccagacgga
gaattcgaactcatgtcctaccgcctcaacacccatgtgaagcctttgatctggatcgag
tccgtgattgaaaagcattcccacagccgcattgagtacatggtcaaggccaagagccag
ttcaagcggcggtcaacagccaacaatgtggagatccacatcccagtccccaatgacgcc
gactcacccaagttcaagaccacggtggggagtgtcaagtgggtccctgaaaacagtgag
atcgtgtggtccatcaaatccttcccgggtggcaaggagtacctgatgcgggcccacttc
ggccttcccagtgtggaagcggaagacaaggagggcaagcctcccatcagcgtcaagttc
gagatcccctatttcactacctctggcatccaggtgcgctacctgaaaatcattgagaag
agcgggtaccaggccctgccctgggtacgctatatcacgcagaatggagattaccagctc
cggacccagtga

KEGG   Rattus norvegicus (rat): 360785
Entry
360785            CDS       T01003                                 

Gene name
Ap1s1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 W
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360785 (Ap1s1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    360785 (Ap1s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360785 (Ap1s1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    360785 (Ap1s1)
SSDB
Motif
Pfam: Clat_adaptor_s DEK_C CNOT1_HEAT
Other DBs
NCBI-GeneID: 360785
NCBI-ProteinID: NP_001101801
RGD: 1305911
Ensembl: ENSRNOG00000001415
UniProt: B5DFI3
Position
12
AA seq 158 aa
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYK
RYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
GDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatgcgattcatgctactgttcagccggcagggaaaacttcggctacaaaaatggtac
ctggccacctcagacaaggagaggaagaaaatggtccgagagctcatgcaggtcgttctg
gctcgaaagcccaaaatgtgcagcttcctggagtggagggacctcaaagttgtctataag
agatatgccagtctctatttctgctgcgccatcgaaggccaagacaatgagctgatcacc
ctggagctgatccaccgatacgtagagctcttggacaagtacttcggcagcgtatgcgag
ttggacatcatcttcaactttgagaaagcgtacttcatcctggatgagtttctgatgggc
ggggacgtccaggacacatccaagaagagtgtcctcaaggctatcgagcaggctgacctg
ctgcaggaggaggatgagtcgccgcgcagtgtcctggaggagatgggcctggcatag

KEGG   Rattus norvegicus (rat): 367038
Entry
367038            CDS       T01003                                 

Gene name
Ap1m2
Definition
(RefSeq) AP-1 complex subunit mu-2
  KO
K12393  AP-1 complex subunit mu
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    367038 (Ap1m2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    367038 (Ap1m2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    367038 (Ap1m2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    367038 (Ap1m2)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s Dymeclin
Other DBs
NCBI-GeneID: 367038
NCBI-ProteinID: NP_001102466
RGD: 1561490
Ensembl: ENSRNOG00000043093
UniProt: B2RZA4
Position
8
AA seq 423 aa
MSASAVFILDVKGKPLISRNYKGDVPMTEIDHFMPLLMQREEEGMLAPLLSHGRVHFLWI
KHSNLYLVATTLKNANASLVYSFLYKTVEVFCEYFKELEEESIRDNFVIVYELLDELMDF
GFPQTTDSKILQEYITQQGNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVN
LLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQ
CVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQ
FKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHF
GLPSVETEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL
RTS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtcggcctcggcagtcttcattctggacgtcaagggcaagcctctgattagccgaaac
tacaaaggcgatgtgcccatgacggagattgaccacttcatgcctctgcttatgcaacgg
gaggaggagggtatgctggccccgctgctgagccacggccgagtgcacttcttgtggatc
aaacacagcaatctctacttggtggccaccacactgaagaacgccaatgcctctctggtg
tactcctttctgtacaagactgtggaggtcttctgcgagtactttaaggagctggaggag
gagagcatccgagacaactttgtcattgtgtacgagctgctggacgagctgatggacttc
ggctttccgcagaccacggacagcaagatcctgcaggagtacatcacacagcagggcaac
aagctggagaccggcaagtctcgagtgccaccgacagtcaccaatgctgtgtcctggcgc
tccgagggcatcaagtacaaaaagaacgaggtcttcattgatgtcatcgagtctgttaac
cttctggtgaatgctaatgggagtgtcttgctcagcgagattgtgggcaccatcaagctg
aaggtgtttctgtctgggatgccagagctgcggctgggcctcaatgaccgagtgctcttt
gagcttactggccgcagcaagaacaagtctgtggagctggaagatgtgaaattccaccag
tgtgtgaggctttcacgcttcgacaacgaccgcaccatctccttcatacccccggatggg
gacttcgaactcatgtcctaccgtctcagcacccaggtcaaacctctgatctggatcgag
tcagtcattgagaaattctcccacagccgagtggagatcatggtgaaggccaagggtcag
tttaagaagcagtcggtggccaacggcgtggaaatctctgtgcctgtacctagcgatgca
gattctccacgcttcaagaccagtgtgggcagtgccaagtatgtgcctgagaagaatgtc
gtcatttggagcatcaagtctttccctgggggcaaggagtacttgatgcgtgcccatttt
ggcctccccagcgtggaaactgaggaggtagagggccggccacccatcggtgtcaagttt
gagattccatactttactgtttccggcatccaggtccgttacatgaagatcatcgagaaa
agcgggtaccaggccctgccctgggtccgctacatcacccagagtggtgattatcaactt
cggaccagctag

KEGG   Rattus norvegicus (rat): 367304
Entry
367304            CDS       T01003                                 

Gene name
Ap1s3
Definition
(RefSeq) AP-1 complex subunit sigma-3
  KO
K12395  AP-1 complex subunit sigma-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    367304 (Ap1s3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    367304 (Ap1s3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    367304 (Ap1s3)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    367304 (Ap1s3)
SSDB
Motif
Pfam: Clat_adaptor_s DUF3387
Other DBs
NCBI-GeneID: 367304
NCBI-ProteinID: NP_001165621
Ensembl: ENSRNOG00000049873
Position
9
AA seq 154 aa
MIHFILLFSRQGKLRLQKWYTTLPDKERKKITREIIQTVLSRGHRTSSFIDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKTAVKAIEDSDMLQETMEEYMNKPTF
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatacatttcatcttgctgttcagtcgacaagggaagctgcggctgcagaaatggtac
accacgctccctgacaaagagaggaagaagatcacccgggagatcatccagaccgtcctc
tctcgtggacacaggaccagcagtttcattgactggaaggagctgaaacttgtttataaa
aggtatgctagtttatatttttgctgtgcaatagaaaaccaagacaatgagctcttgaca
ctagagattgttcatcgttatgtggagttgctggataagtactttggaaatgtctgtgag
ctggacattatctttaattttgagaaggcatattttatccttgacgagtttataataggt
ggagaaattcaggaaacatccaagaaaacagcggtcaaggccattgaagactctgatatg
ttacaagagacaatggaagaatacatgaacaagccgacattttaa

DBGET integrated database retrieval system