KEGG   Rattus norvegicus (rat): 100362725
Entry
100362725         CDS       T01003                                 

Gene name
Cdkl5
Definition
(RefSeq) cyclin-dependent kinase-like 5
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100362725 (Cdkl5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100362725 (Cdkl5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   100362725 (Cdkl5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Pkinase_fungal
Other DBs
NCBI-GeneID: 100362725
NCBI-ProteinID: XP_017443711
RGD: 2324133
Ensembl: ENSRNOG00000003742
Position
Xq14
AA seq 1001 aa
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSTKRKPYHVESSTLSNRSQSTKGGALQTHHRSNSKDIQNLSVGLPRAEEGL
PANESFLNGNLAGATLSPMHTKTYQASTQPGSSSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDPKPSEGPGTKYLKSSTRSQQNRHSFMESSQSKAGTLQPSEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQITETNTSRYFPSSCLDLNSPTSPTPTRHTDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGIDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RPSVKESSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSDSSSGTNHSKRQPGFDPWKSPENISHSDQLKEKEKQGFF
RSMKKKKKKTQTTDSTNGENPSIKKSLFPLFNSKNHLKHSSSLKKLPVVTPPMVPNTDGP
DLLTLQKAIHSSSTASSRPKEWRPEKLSDLQTQSQPLKSLRKLLHLSSSTNHPASSDPRF
QPLTAQQAKNSFSEIRIHPLSQASGGSSNIRQEPTPKGRPALQLPGQMDPGWHVSSVTRS
ATEGPSYSEQLGAKSGPNGHPYNRTNRSRMPNLNDLKETAL
NT seq 3006 nt   +upstreamnt  +downstreamnt
atgaagattcctaacattggtaatgtgatgaataaatttgagatccttggggttgttggt
gaaggagcctatggagttgtacttaaatgcagacacaaggaaacacatgaaattgtggca
atcaagaaattcaaggacagtgaagaaaatgaagaagtcaaggagacgactttacgagag
cttaaaatgcttcgcactctcaagcaggaaaacattgtggagctgaaggaagcttttcgt
cggagaggaaaactatacctggtgtttgaatatgttgagaaaaatatgcttgaattgctg
gaagagatgccaaacggagttccacctgaaaaggttaaaagctatatctaccaactaatc
aaagccatccactggtgccacaagaacgacattgtccacagagatataaagcctgaaaat
ctcttaatcagccacaatgatgtcctgaaactgtgtgactttggttttgctcggaatctc
tcagaaggaaacaatgctaattacacagaatacgtggctactcggtggtaccgatctcca
gaactgctacttggagccccctatggaaagtcagtggacatgtggtcagtgggctgtatt
cttggagagctcagtgatggacagcccttatttcctggggaaagtgaaattgaccaactc
tttactattcagaaggtgctaggaccacttccgtctgagcagatgaagctcttctacagt
aatcctcgtttccatgggctccggtttccagctgttaaccatcctcagtcattagagaga
cgataccttggaattttaaatagtgttttacttgacctaatgaagaatttactgaagttg
gacccagctgacagatacttgacggagcagtgtttgaatcaccctacatttcaaactcag
agacttttggaccggtctccttcaaggtcaacaaaaaggaagccttaccatgtggaaagc
agcacactgtctaatagaagccaatccaccaagggtggtgctttacagactcatcacaga
tccaacagcaaggacattcagaacttaagtgtgggtctgcccagagctgaggaaggcctg
cctgcaaatgaaagcttcctaaatggaaaccttgctggagcaactctcagtccaatgcac
accaaaacgtaccaagcaagtacccagcctgggtcttccagcaaagatctcacaaacaac
aatataccgcaccttctcagtccaaaagaagccaagtccaaaacagagtttgacttcaat
attgacccaaagccttcagaaggtccaggcacaaagtacctcaagtccagcaccagatct
caacagaacagacactcattcatggaaagttcccagagcaaagctgggacactgcagcct
agtgagaagcagagtcggcacagctatattgacaccatcccccagtcttccaggagtcca
tcctacaggacaaaggccaaaagccatggggctttgagtgactccaagtctgtgagcaac
ctttcagaagccagagcccaaatcacagagactaataccagtagatatttcccatccagt
tgtttggacttgaactctcccaccagcccaacacccaccaggcacactgatacgagaact
ttgctcagcccttccgggagaaataatcgaaatgagggcactctggactcccggcgaacc
accaccagacactcaaaaaccatggaagagttgaagctgcctgaacacatggatagcagc
cattcacattcgctgtctgcacctcatgaatcattttcttatgggctaggctataccagc
cccttctcctctcaacaacgtcctcacaggcattccatgtatgtgacccgggacaaagtg
agagctaaaggcattgacggaagcttgagcatagggcaagggatggcagccagagccaac
agcttgcagctgttatcaccccagcctggagaacagcttcctccagaaatgactgtggca
agaccttctgtaaaagagtcctcccgagaaggcacctcttcgttccacacccgtcagaaa
tctgagggtggagtataccatgacccacactctgacgacggcacggctcccaaagaaaat
cggcatctgtacaatgatcctgtcccaaggagagttggtagcttttatagagtgccatct
ccacgaccagacaattctttccatgaaaataatgtgtccactcgagtttcttctctgcca
tcggatagtagttctggcacaaatcattcaaaaagacaaccaggatttgatccgtggaaa
agtcctgaaaacattagtcattccgatcaactcaaagaaaaggagaagcaaggctttttc
aggtcaatgaaaaagaaaaagaagaaaactcaaacaacagactccaccaacggggagaat
ccaagcatcaagaaatccctcttccctctttttaattcaaagaaccatttaaagcatagt
tcttctttgaaaaagcttcctgtagtcactccacccatggtgcccaacactgatggtcct
gatttattgaccttacagaaagccattcattcttctagcactgcaagcagcagaccaaag
gagtggcgacctgaaaagctttcagatctacagacccagagccaaccactaaaatccctt
cgcaagctgctgcatctttcttcgtcaaccaatcacccggcttcttcagatcctcggttc
cagccgttaacagctcaacaagccaaaaattccttctcagaaattcggattcaccctctg
agtcaggcctctggtgggagcagcaacatccggcaggagcctacaccaaaaggcagacca
gcccttcagctgccaggtcagatggatcctggttggcacgtgtcctctgtgaccaggagt
gccacagaggggccttcctattctgaacagctaggtgccaagagtgggccaaacgggcac
ccttataacagaacaaatcgctcacgaatgccaaatctgaatgatttaaaagaaacagcc
ttgtaa

DBGET integrated database retrieval system