KEGG   Rattus norvegicus (rat): 100363064
Entry
100363064         CDS       T01003                                 

Definition
(RefSeq) CD209 antigen-like protein E
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100363064
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100363064
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100363064
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100363064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100363064
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    100363064
   04090 CD molecules [BR:rno04090]
    100363064
   04091 Lectins [BR:rno04091]
    100363064
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100363064
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100363064
CD molecules [BR:rno04090]
 Proteins
  100363064
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100363064
SSDB
Motif
Pfam: Lectin_C UL45 DASH_Dam1 Lectin_N
Other DBs
NCBI-GeneID: 100363064
NCBI-ProteinID: XP_038945816
RGD: 2324825
Position
12
AA seq 285 aa
MGLYKSQVRGKEETGSPEKQKMAGKPELHQLNNHEEEVTLEDQGFAENDPEGLICSSKSL
QGHLTRAPWLLLLLISLGLFLLMLAILVQVSRICANPQGQTQDQKGSSSLGKVAVPQEQT
HTGLEQIQQIQQIQQQLTQFNASLAGLCRPCPWDWEFFQGSCYLFSRTLASWGASASSCK
DLGAHLVIINSVAEQRFMKYWNVRKNQRSWIGLSDHLREGSWQWVDHSPLKFSFWKEGEP
NNDGDEDCVELFMDEWNDNTCTQQNFWVCEQPSAPCPGHGRSVLS
NT seq 858 nt   +upstreamnt  +downstreamnt
atggggttatataaatcccaggtcagagggaaggaggagacggggagtccagagaagcag
aagatggcaggaaagccagagctccaccagctgaacaaccatgaggaggaggtcacattg
gaagaccagggatttgctgagaatgaccccgagggtctcatttgcagctccaagagtttg
caaggacatctgacccgagccccctggcttctgctgcttctcatctctttgggcctcttt
ttgcttatgttggccatcctggttcaagtttccaggatctgtgcaaacccacagggacag
acccaggatcagaaggggagttccagcttggggaaagttgctgttcctcaggagcagaca
cacactggcttggagcagatccagcagatccagcagatccagcagcagctgactcagttc
aatgcctcgctggctggcctgtgccggccctgtccctgggactgggagttcttccaggga
agctgctacctcttctcgagaaccctggccagctggggagcctctgcctcctcctgcaag
gatcttggggcccacctggtgatcatcaacagtgttgcagagcagagattcatgaaatat
tggaatgtgaggaaaaaccaacgttcctggatcggcctcagtgaccatttacgcgagggt
tcctggcaatgggtggatcacagccctctcaagttcagcttttggaaagagggggagcct
aacaatgacggggatgaggactgcgtggagctgttcatggatgagtggaatgataatacg
tgcacccagcaaaacttctgggtctgtgagcagccctcggctccctgccctggccatgga
cggtctgtgctctcctag

KEGG   Rattus norvegicus (rat): 288375
Entry
288375            CDS       T01003                                 

Gene name
Cd209a
Definition
(RefSeq) CD209a antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    288375 (Cd209a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    288375 (Cd209a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    288375 (Cd209a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    288375 (Cd209a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288375 (Cd209a)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    288375 (Cd209a)
   04090 CD molecules [BR:rno04090]
    288375 (Cd209a)
   04091 Lectins [BR:rno04091]
    288375 (Cd209a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    288375 (Cd209a)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   288375 (Cd209a)
CD molecules [BR:rno04090]
 Proteins
  288375 (Cd209a)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    288375 (Cd209a)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 288375
NCBI-ProteinID: NP_001099374
RGD: 1308239
Ensembl: ENSRNOG00000040128
Position
12
AA seq 240 aa
MSESKETGKQQLGPLDEELLTSSHTRYSMKGFGFQPNSGFSSFTGYLVHSHVPLALKALF
LTVFSVLLVVILVKVYKIPSSHEQEESNQKNFYQELIQLKAGVDRLCRSCPWDWTAFQGN
CYFFSVAQKSWNDSATACHNVGAQLVVIKSEEEQNFLQKTSKKRGYTWMGLIDINKESTW
HWVDGSPLTLTFMKYWNKGEPNNVGDKDCAEFREDGWNDTKCDNKKFWICKKPETSCSSK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagtgaatctaaggaaacagggaagcagcagcttggccctctggatgaggaactgctg
acatccagccacaccaggtactctatgaaaggttttggcttccaaccaaattctggattc
agtagcttcacaggatacctggtccacagccatgttcccttggcactgaaggcgctcttc
ctcactgtgttctctgtgctgctggttgtcatccttgttaaagtctataagatccccagt
tctcatgaacaggaggagtccaatcagaagaatttctaccaggaactgatccagttgaag
gctggggtagatcgcctgtgccgctcctgcccctgggactggacagccttccaaggaaac
tgctactttttctctgttgcccagaagtcctggaatgattctgccactgcctgccacaat
gtgggggctcaacttgtagtcatcaagagtgaagaagaacagaactttctacaaaaaact
tctaagaagagaggctacacttggatggggctcatagacatcaacaaggaatctacatgg
cactgggtagatggttcacctctgaccctcacttttatgaagtattggaataaaggggaa
cctaacaacgtcggagacaaagactgtgcagagttcagagaagacggctggaatgacacc
aaatgtgacaacaagaaattctggatctgcaaaaaacctgaaacgtcctgctctagcaag
tga

KEGG   Rattus norvegicus (rat): 288378
Entry
288378            CDS       T01003                                 

Gene name
Clec4m
Definition
(RefSeq) CD209b antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    288378 (Clec4m)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    288378 (Clec4m)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    288378 (Clec4m)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    288378 (Clec4m)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288378 (Clec4m)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    288378 (Clec4m)
   04090 CD molecules [BR:rno04090]
    288378 (Clec4m)
   04091 Lectins [BR:rno04091]
    288378 (Clec4m)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    288378 (Clec4m)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   288378 (Clec4m)
CD molecules [BR:rno04090]
 Proteins
  288378 (Clec4m)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    288378 (Clec4m)
SSDB
Motif
Pfam: Lectin_C GlnE IIGP FUT8_N_cat TRP HERV-K_REC
Other DBs
NCBI-GeneID: 288378
NCBI-ProteinID: NP_001163868
RGD: 1561466
Ensembl: ENSRNOG00000029881
UniProt: Q5BK08 F1LM87
Position
12
AA seq 319 aa
MQPLDSMEDGEMEVSGSRYSIKSSRLRPNSGIKSLAGCLGHNQAPLVLQLLSFLFLAGLL
LIILFQVFKTTNTQWQEEPKQEKILEELNQLTDELMSRIPISQGQNESMQEKISEQLTQL
KVELLSRIPVFQVQNESMQEKISEQLTQLKAELLSKIPSLQVQDESKQEKIYQQLVQMKT
ELLRLCRLCPWDWTFLLGNCYFLSKSQRNWNDAVRACKEEKAQLVIINSDEEQTFLQLTS
KAKGPTWMGLSDLKNEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSK
CELKKFWIFKKSATACTEG
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcagcctcttgattccatggaggacggcgagatggaggtcagtggcagcaggtattct
attaaaagctccagactacgaccaaattctggaatcaagagtttggcaggatgcctggga
cacaaccaagcccccttggtcctgcagctgctctctttcctgttcttggctgggctcctg
ctgatcattcttttccaagtcttcaagaccacaaatacccagtggcaggaggaacccaag
caagagaagatccttgaggaactgaaccagctgacagacgaacttatgtccaggatcccc
atctcccaggggcagaatgagtccatgcaggagaagatctctgagcaactgactcagctg
aaggttgaactcctatccaggatccccgtcttccaagtgcagaatgaatccatgcaagag
aagatctctgagcaactgacacagctgaaggctgaactcctttccaagatccccagcctc
caggtacaggatgagtctaagcaggagaagatctaccaacagctggtacagatgaagact
gaactcctccgcctgtgtcgactctgcccctgggactggacattcctcctaggaaactgt
tacttcttatccaagtcccaacggaactggaatgatgccgtcagagcttgcaaagaagag
aaggctcaattagtcatcatcaatagtgatgaagagcagaccttcctacagctgacttct
aaggctaaaggaccaacctggatggggctgtcagacctgaagaatgaagccacatggctc
tgggtagatggttctactctgtcatccagattccagaaatattggaatagaggggagccc
aacaacatcggtgaagaagactgtgtagaatttgctggggatggctggaatgactccaaa
tgtgaactcaaaaagttctggattttcaagaagtctgcgaccgcatgcactgaaggctag

KEGG   Rattus norvegicus (rat): 288386
Entry
288386            CDS       T01003                                 

Gene name
RGD1559710
Definition
(RefSeq) CD209 antigen-like protein C
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    288386 (RGD1559710)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    288386 (RGD1559710)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    288386 (RGD1559710)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    288386 (RGD1559710)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288386 (RGD1559710)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    288386 (RGD1559710)
   04090 CD molecules [BR:rno04090]
    288386 (RGD1559710)
   04091 Lectins [BR:rno04091]
    288386 (RGD1559710)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    288386 (RGD1559710)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   288386 (RGD1559710)
CD molecules [BR:rno04090]
 Proteins
  288386 (RGD1559710)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    288386 (RGD1559710)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 288386
NCBI-ProteinID: XP_038945830
RGD: 1559710
Position
12
AA seq 250 aa
MSNSKKVRELKTSGIRSSSKGSGLQPSFELYRFSVVSVSSSQSEEHIYTEVTEVKPKIGC
VRHGLVPLVLQLLFFTLFSGVLVTFLLQVPKVPCTKDQEEIYKKLTQLKTRIDLLCRPCS
WDWMLFHGNCYFFSITKHNWNDSLTACKEVGAQLIIIESDEEQTFLQKMCKSIGNLWIGL
SDIKEEGSWQWVDGSPLSLSFKNKYWTPWETKNASEKDCVELTNDGWNDNNCTLKNFWIC
KKSSISCFKN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgagtaactccaagaaagtcagggaattgaagaccagtggcatcagatcttcctctaag
ggctctgggctccagccaagttttgaactttatagattttcagttgtcagtgtctccagt
tcccagagtgaagagcatatctatactgaagtgacagaggtaaaacctaaaattgggtgt
gtgagacatggccttgttcccttggtgctgcagctgcttttcttcactctcttctctggg
gtccttgtgacatttcttctccaagttccaaaggtgccctgcaccaaggatcaggaggaa
atctacaagaaactcacacaactgaagactcgaatagacctcctatgtcgtccctgctcc
tgggactggatgcttttccatggaaattgttacttcttctccataactaaacataactgg
aatgattctctcactgcttgcaaggaagtaggggcacaactcatcatcattgaaagtgat
gaggagcagacctttctacagaagatgtgtaagagtataggaaatctctggattgggctc
tcagacataaaagaggaaggctcatggcagtgggtggatggttcacctctgtcactaagc
tttaaaaacaaatattggaccccgtgggaaaccaaaaatgcttcagagaaagactgtgta
gagctgacaaatgatggctggaatgacaacaattgtacattgaagaatttctggatctgc
aagaaatcgtcaatatcgtgcttcaaaaattga

KEGG   Rattus norvegicus (rat): 304197
Entry
304197            CDS       T01003                                 

Gene name
RGD1564571
Definition
(RefSeq) CD209 antigen-like protein E
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    304197 (RGD1564571)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    304197 (RGD1564571)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    304197 (RGD1564571)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    304197 (RGD1564571)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304197 (RGD1564571)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    304197 (RGD1564571)
   04090 CD molecules [BR:rno04090]
    304197 (RGD1564571)
   04091 Lectins [BR:rno04091]
    304197 (RGD1564571)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    304197 (RGD1564571)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   304197 (RGD1564571)
CD molecules [BR:rno04090]
 Proteins
  304197 (RGD1564571)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    304197 (RGD1564571)
SSDB
Motif
Pfam: Lectin_C DUF4083
Other DBs
NCBI-GeneID: 304197
NCBI-ProteinID: XP_221808
RGD: 1564571
Position
12
AA seq 207 aa
MRVFNRERKKHLHSLGCQDHEYFITVLQLISIVLLAALLTAILVKGSEVPSSQEHDQQKQ
RMHQKLDQLKTGLDHLCRPCPWDWTFFQGNCYFFSTFQKKWKESVIACKDMGAQLVVIKS
YEEQSFLQRTSKMKGNTWIGLSDSQEEDQWLWVDGSPLQWRNYWSAGEPNNLYDEDCVEF
SSYGWNDISCSFEKFWICKKSASPCPR
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagagtcttcaacagagagaggaagaaacatctgcactccttggggtgtcaggaccat
gaatatttcatcactgtgctgcagctcatctccattgtgctcttggctgctctcctcacg
gctatccttgtcaaaggctctgaggttcctagttcccaagagcatgatcagcaaaagcaa
cgcatgcaccagaaactggaccagctgaagactggactagaccacctgtgccgcccctgc
ccctgggactggacgttctttcaaggaaactgttactttttctctactttccaaaagaaa
tggaaggaatctgtcattgcctgcaaggacatgggggcccaactagtggtcataaaaagt
tatgaggagcagagcttcctccagaggacttctaagatgaaaggcaatacctggataggg
ctgtcagactcacaagaggaagaccaatggctgtgggtagatggctcaccactgcagtgg
aggaactattggtctgcaggggagcccaacaatttgtacgatgaagactgtgtggaattt
tcaagttatggatggaatgatatctcatgttcctttgagaagttctggatctgtaagaag
tctgcatctccttgccctaggtga

KEGG   Rattus norvegicus (rat): 363856
Entry
363856            CDS       T01003                                 

Gene name
Cd209
Definition
(RefSeq) CD209 molecule
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    363856 (Cd209)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    363856 (Cd209)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    363856 (Cd209)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    363856 (Cd209)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363856 (Cd209)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    363856 (Cd209)
   04090 CD molecules [BR:rno04090]
    363856 (Cd209)
   04091 Lectins [BR:rno04091]
    363856 (Cd209)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    363856 (Cd209)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   363856 (Cd209)
CD molecules [BR:rno04090]
 Proteins
  363856 (Cd209)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    363856 (Cd209)
SSDB
Motif
Pfam: Lectin_C UL45 HERV-K_REC FtsX TRP
Other DBs
NCBI-GeneID: 363856
NCBI-ProteinID: NP_001102319
RGD: 1561104
Ensembl: ENSRNOG00000001017
UniProt: D3ZXN3
Position
12
AA seq 237 aa
MSESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLS
FLFLAGLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFF
SKSQRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVD
GSPLSPSFAQYWNRGEPNNVGDEDCAEFSGDGWNDLRCDTRIFWICKKVSTSSCTIK
NT seq 714 nt   +upstreamnt  +downstreamnt
atgagtgagtccatggaatcaaacacacagcaactggacaatccagaggatgaagagtat
ttgatgagtggttccaggtattctattatcagctctcgattacgaacaaaatttggaatc
aaaagtttggcagaatatacgaagcagagccacaaccccttggtcctaccgctgctctcc
ttcctgttcttggctggccttctgctgatcattcttgtcctagtctcaaaggtacccagc
tcagaagttcaggacaaaatctaccaggagctcatgcaactgaagactgaagtccatgat
ggcttgtgtcaaccctgtccgagggattggacattcttcaatggaagctgttacttcttc
tccaagtcccaaagaaactggcacaactccatcactgcctgcaaggaactgggggctcaa
ttggtcatcgtagagacggatgaagagcagaccttcctgcagcagacttctaagactagg
ggaccaacatggatgggtctctcagacatgcataatgaagccacgtggcactgggtggat
ggctcacctctgtcacccagctttgcacagtattggaatagaggggagcccaacaatgtc
ggtgatgaggattgtgcagagttctctggggacggctggaatgacctcagatgcgatacc
cggattttctggatctgtaagaaagtttcaacctcatcatgtaccatcaaatga

KEGG   Rattus norvegicus (rat): 501797
Entry
501797            CDS       T01003                                 

Gene name
Cd209e
Definition
(RefSeq) CD209 antigen-like protein E
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    501797 (Cd209e)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    501797 (Cd209e)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    501797 (Cd209e)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    501797 (Cd209e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501797 (Cd209e)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    501797 (Cd209e)
   04090 CD molecules [BR:rno04090]
    501797 (Cd209e)
   04091 Lectins [BR:rno04091]
    501797 (Cd209e)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    501797 (Cd209e)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   501797 (Cd209e)
CD molecules [BR:rno04090]
 Proteins
  501797 (Cd209e)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    501797 (Cd209e)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 501797
NCBI-ProteinID: NP_001178934
RGD: 1563333
Ensembl: ENSRNOG00000028803
UniProt: D3ZCF3
Position
12
AA seq 207 aa
MRIQQMGSLGFLDRSNIPLVLQLLFLILFAGLLVAIVIQVSKIPSSEEVQWEQTKQEKMY
QDLSQLKSEIDSLCRLCPWDWTFFNGNCYFFSKSQRDWHNSITACQEMEAQLVTIKSPEE
QSFLQQTSKKNGYTWMGLSDLNKEGEWYWLDGSPLSDSLRNYWNEGQPNNIDGQDCVEFR
NDGWNDAKCDNWKFWICKKTATTCSSK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaggatacagcagatgggctctctgggatttctagaccggagcaacattcccttggtg
ctgcagctgctgttcctcattctctttgctggactcctggtggccattgtcatccaagtt
tccaagatccccagctcagaagaagttcagtgggaacagacaaagcaagagaaaatgtac
caggacctaagccaactgaagtctgaaattgatagcctctgccgcctctgcccttgggat
tggacattcttcaatggaaactgttactttttctccaagtcacaacgggactggcacaac
tccatcactgcctgccaagaaatggaggcccaactagtcaccatcaaaagtcccgaggag
cagagcttcctacagcagacttccaagaaaaatggctacacctggatggggctgtcagat
ctgaacaaggaaggcgagtggtactggctggatgggtcacctctgtcagacagcctcagg
aactattggaatgaaggacagcccaataatattgatggacaagactgtgtggaattcaga
aatgatggctggaatgatgccaaatgcgacaattggaaattctggatctgcaaaaaaact
gcaactacctgttccagcaagtga

KEGG   Rattus norvegicus (rat): 688750
Entry
688750            CDS       T01003                                 

Gene name
Cd209f
Definition
(RefSeq) CD209 antigen-like protein 2 isoform X1
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    688750 (Cd209f)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    688750 (Cd209f)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    688750 (Cd209f)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    688750 (Cd209f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    688750 (Cd209f)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    688750 (Cd209f)
   04090 CD molecules [BR:rno04090]
    688750 (Cd209f)
   04091 Lectins [BR:rno04091]
    688750 (Cd209f)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    688750 (Cd209f)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   688750 (Cd209f)
CD molecules [BR:rno04090]
 Proteins
  688750 (Cd209f)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    688750 (Cd209f)
SSDB
Motif
Pfam: Lectin_C DASH_Dam1
Other DBs
NCBI-GeneID: 688750
NCBI-ProteinID: XP_001068161
RGD: 1585258
Ensembl: ENSRNOG00000042317
Position
12
AA seq 277 aa
MGLYKSQVRGKEERGSPEKQKMAGKPELHQPNNHEEEVTLEDHDPEGLICSSKSLQGHLT
RAPWLLPLLISLGLFLLMLATLVQISRICANPQGQTQDQKGSSSFGKVAVPQEQTYTGLE
QIQQIQQQLTQFNASLAGLCRPCPWDWEFFQGSCYLFSRTLASWGASASSCKDLGAHLVI
VNSVAEQQFLKYWHIRQSQLTWIGLSDHQREGSWQWVDDTPLKLSFWKEGEPNNAGDEDC
VVIAEDKWNDSTCSANNFWVCEQPSTPCPGHARSALP
NT seq 834 nt   +upstreamnt  +downstreamnt
atggggttatataaatcccaggtcagagggaaggaggagagggggagtccagagaagcag
aagatggcaggaaagccagagctccaccagccgaacaaccatgaggaggaggtcacattg
gaagaccatgaccctgagggtctcatttgcagctccaagagtttgcaaggacatctgacc
cgagccccctggcttctgccgcttctcatctctttgggcctctttttgcttatgttggcc
accctggttcaaatttccaggatctgtgcaaacccacagggacagacccaggatcagaag
gggagttccagctttgggaaagttgctgttcctcaggagcagacatacactggcttggag
cagatccagcagatccagcaacagctgactcagttcaacgcctcgctggctggcctgtgc
cggccctgtccctgggactgggagttcttccagggaagctgctacctcttctcgagaacc
ctggccagctggggagcctctgcctcctcctgcaaggatcttggggcccacctggtgatc
gtcaacagtgttgcagagcagcaattcctcaaatactggcacatcagacagtctcagctt
acctggattggcctcagcgatcatcaacgcgaaggttcctggcagtgggtggatgacacc
ccacttaaactcagcttctggaaagagggggagcccaataatgcaggggacgaggactgt
gtggtcatagcagaagataaatggaatgacagcacttgttctgcaaacaacttctgggtc
tgtgagcagccctcgactccctgccctggtcacgcaaggtctgcgcttccctag

KEGG   Rattus norvegicus (rat): 688858
Entry
688858            CDS       T01003                                 

Definition
(RefSeq) CD209 antigen-like protein E
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    688858
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    688858
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    688858
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    688858
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    688858
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    688858
   04090 CD molecules [BR:rno04090]
    688858
   04091 Lectins [BR:rno04091]
    688858
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    688858
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   688858
CD molecules [BR:rno04090]
 Proteins
  688858
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    688858
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 688858
NCBI-ProteinID: XP_038945829
RGD: 1584108
Position
12
AA seq 207 aa
MILSMELNEKQQLGPLGCVRHSHGLVVLHLLSIVLLAGLLVTVLIQGFKDPSSSVNEKIY
KQLMQLGIGVDSLCRPCPWEWTFFHGRCYYFSKSQRNWNDSVAACQEVDAQLVTVESDEE
QTFLDTFLKNKGPAWMGLSDLKQESTWQWVDGSPLSDSFRKYWIKGEPNNQGNEDCAELR
EDGWNDNKCDNKKFWICKKPETSCSSK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgattctctccatggaattaaatgagaagcagcagctaggccccctagggtgtgtgagg
cacagccatggccttgtggtgttgcatctgctctccatcgtgctcctggctgggcttctg
gtgactgttctcattcaaggttttaaggatccaagctcatcagtgaatgaaaaaatctac
aagcaactgatgcaactggggattggagtggacagcctttgccgtccttgcccttgggaa
tggacattcttccacggaagatgttattacttctccaaatcccagcgtaactggaatgat
tctgttgctgcttgccaggaagtggatgctcaactagtcactgttgagagtgacgaagaa
cagacattcctggatacgttcttaaagaataaaggacctgcctggatgggtctctcagac
ttgaaacaggaaagcacgtggcagtgggtagatggctcacctttgtcagacagtttcagg
aagtattggataaaaggggaacctaacaaccagggaaatgaagactgtgcagagctcaga
gaagacggctggaatgacaacaaatgtgacaacaagaaattctggatctgcaaaaaacct
gaaacgtcctgctctagcaaatga

KEGG   Rattus norvegicus (rat): 688951
Entry
688951            CDS       T01003                                 

Gene name
Cd209c
Definition
(RefSeq) CD209 antigen-like protein C
  KO
K06563  C-type lectin domain family 4 member M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    688951 (Cd209c)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    688951 (Cd209c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    688951 (Cd209c)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    688951 (Cd209c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    688951 (Cd209c)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    688951 (Cd209c)
   04090 CD molecules [BR:rno04090]
    688951 (Cd209c)
   04091 Lectins [BR:rno04091]
    688951 (Cd209c)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    688951 (Cd209c)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   688951 (Cd209c)
CD molecules [BR:rno04090]
 Proteins
  688951 (Cd209c)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    688951 (Cd209c)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 688951
NCBI-ProteinID: XP_006248854
RGD: 1582956
Position
12
AA seq 240 aa
MGDSEEDRVQQLSSLDEEHLIASSTRYSLQGFRFQPPYILKKAAGYLCHGLVPFVLQLIC
LTLCAILLLAILIKVSNVAYSQGQEQAKKEKVYQDVAQLKPQINHLCRPCPWDWTFFQGN
CYFFSKFQQNWKDSVTSCRKLGAQLVVVKSDDEQSFLQQTSKEKGYAWMVLSDLKREGIW
HWVDGSHLLFSFTKYWNKGEPNNEWEEDCAEFRGDGWNDAPCTNKKYWICKKSALSCTGK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggtgactctgaggaagacagagtacagcaactgagttccctggatgaggagcacctg
atagccagcagcaccagatactccctccaaggcttcagatttcaacctccctacatcctc
aagaaagctgcagggtatctgtgccatggccttgttcccttcgtgctgcagctgatctgc
ctcacactctgtgctatcctcctgctggctatccttatcaaagtctctaatgttgcctac
tcccagggacaggaacaggcaaagaaggagaaggtataccaggatgtggcccagctgaag
cctcaaataaaccatctgtgccgcccctgcccctgggactggacattcttccaaggaaac
tgttacttcttctccaagttccaacagaactggaaggactctgtcaccagctgcagaaaa
ctgggtgctcaactagtggtcgtcaaaagcgacgatgagcagagcttcctgcaacagaca
tctaaagagaaaggctatgcctggatggtcctgtcagacctgaagcgtgaaggcatatgg
cactgggtggacggctcacatctgctcttcagtttcacgaaatattggaacaaaggagag
cccaacaacgaatgggaagaagactgtgcggagttcagaggcgatggctggaatgatgcc
ccatgtacaaataagaaatactggatctgcaagaagtctgctctgtcctgcactgggaaa
tga

DBGET integrated database retrieval system