KEGG   Rattus norvegicus (rat): 100363116
Entry
100363116         CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC100363116
  KO
K09131  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    100363116
SSDB
Motif
Pfam: DUF167 ThiP_synth LAL_C2
Other DBs
NCBI-GeneID: 100363116
NCBI-ProteinID: XP_003750283
RGD: 2324773
UniProt: Q505I4
Position
6q32
AA seq 126 aa
MPKKAGATSKGKNQTKEPETPPPPTGPVATDSKGFVTIAIHAKPGSKQNAVTDLNTEAVG
VAIAAPPSEGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEKLR
TEAEKK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctaagaaagccggtgcaacaagcaagggtaaaaaccaaaccaaggaaccagagaca
ccacctccccctacagggcctgtagcaactgattctaaaggctttgtcaccatagccatc
catgccaaacccggctccaaacagaatgctgtgacagatctgaacaccgaggcggttggc
gtggccatcgcggcacctccgtctgagggagaggccaatgcggagctctgtcggtacctt
tccaaggtcttggacctcaggaagagtgacgtggttctggacaagggcggtaaatctcgg
gaaaaggtggtgaagctcttggcctctacaactccagaggaggtcttggagaagctgaga
acagaagctgaaaaaaaataa

DBGET integrated database retrieval system