KEGG   Rattus norvegicus (rat): 100363178Help
Entry
100363178         CDS       T01003                                 

Gene name
Tmigd3
Definition
(RefSeq) transmembrane and immunoglobulin domain containing 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set
Motif
Other DBs
NCBI-GeneID: 100363178
NCBI-ProteinID: NP_001289678
RGD: 2324712
Ensembl: ENSRNOG00000043375
Vega: OTTRNOG00000000717
UniProt: Q4V8H0
Position
2q34
AA seq 232 aa AA seqDB search
MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagcccctcctactgctctccttggctctcttttccgatgccatggtcatggatgaa
aaggtgaaatcaggcgttgagctggacacagcttctgcaatctgtaactatgacgcccac
tacaaggaccacaccaagtactggtgccgtggctatttcagggactcgtgcaacattatt
gccttcacccctaatagcagcaaccgtgtggccctgaaagacacaggagaccaactcatc
atcactgtctcctgcctggtcaaggaggacacaggctggtactggtgtggtatccagcgg
gactttgccagagatgacatggattttacaaagctgattgtgactgacaacagagaagac
cgggccaatggcctttcacctggcacttcaggcaacaggacccggagctgtaagacgtcc
aaagctgttcaaaaggcagagggctcccgaatgtccattctgatcgtttgtgtactgatt
agcgggctggggatcatctttttaatcagtcatatgtccagaggaagacgaagccaaaga
aacagaggagttactggcaaaagcatcaatagaaacccacaagcaagtcaagctccgtcc
atggtctccatccccttgactgtccttcccaaggtcccaagacaaaatggtcaacaaaaa
gccctccaatggactggaaatgccacaaagaccggataa

DBGET integrated database retrieval system