KEGG   Rattus norvegicus (rat): 100363225
Entry
100363225         CDS       T01003                                 

Definition
(RefSeq) disks large homolog 5-like isoform X1
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04720  Long-term potentiation
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04921  Oxytocin signaling pathway
rno04931  Insulin resistance
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100363225
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100363225
   04024 cAMP signaling pathway
    100363225
   04022 cGMP-PKG signaling pathway
    100363225
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100363225
   04218 Cellular senescence
    100363225
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100363225
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100363225
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100363225
  09152 Endocrine system
   04910 Insulin signaling pathway
    100363225
   04921 Oxytocin signaling pathway
    100363225
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100363225
   04270 Vascular smooth muscle contraction
    100363225
  09156 Nervous system
   04728 Dopaminergic synapse
    100363225
   04720 Long-term potentiation
    100363225
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100363225
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100363225
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100363225
  09165 Substance dependence
   05031 Amphetamine addiction
    100363225
   05034 Alcoholism
    100363225
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100363225
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100363225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    100363225
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100363225
   03019 Messenger RNA biogenesis [BR:rno03019]
    100363225
   03041 Spliceosome [BR:rno03041]
    100363225
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100363225
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100363225
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100363225
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100363225
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100363225
SSDB
Motif
Pfam: Takusan CENP-F_leu_zip DUF1348
Other DBs
NCBI-GeneID: 100363225
NCBI-ProteinID: XP_038956644
RGD: 2323415
Position
19
AA seq 220 aa
MFSRLRKRFGRGNVDSGETRVKESGLSSQSNDGQRQHFWRMFNAGRETSSPETALSEKQA
KKEKERLIKELQLITEERNDLRYRLRFLTERSKNNRPHFRPNPYYEDLERMEEVVMSILH
NLEMENTEIHENSHKLKKEITFSRNLLSQLLMENTCRKKLVPQKQGSKEGHLDCALNQKY
LVDFNKKDKDQQRPDPASSGLRKCKRTGIGHTPVRELPEE
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttttcccgtcttcgcaagcgttttgggagggggaacgtcgattctggagagactaga
gtgaaggagtctggcctttcctctcaaagtaatgatggacaaagacagcacttctggaga
atgttcaacgctgggagagaaacatcttcccctgaaactgccctaagcgagaagcaggcc
aagaaggaaaaggagaggctgattaaagagctgcagctcattaccgaggagagaaatgac
ctgagatatcgcctgaggtttctgacagagagatccaagaacaacaggccacacttcagg
ccaaatccgtattacgaagacctggagagaatggaggaggtggtcatgtcaattctgcac
aacttagagatggagaacactgagatccatgagaacagccataagctgaagaaggagatt
accttctctagaaacctgctcagccagctcctgatggagaacacatgtaggaagaagttg
gtcccacagaagcaggggagcaaggagggacatcttgattgtgcactgaaccagaaatat
ttggttgacttcaacaagaaagataaagaccagcaacgtccagatccagcatcatcaggt
ctcagaaagtgcaagagaactggaattggacacacaccagtaagagagcttcctgaagaa
tga

KEGG   Rattus norvegicus (rat): 116670
Entry
116670            CDS       T01003                                 

Gene name
Ppp1r12a
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04270  Vascular smooth muscle contraction
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116670 (Ppp1r12a)
   04022 cGMP-PKG signaling pathway
    116670 (Ppp1r12a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116670 (Ppp1r12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116670 (Ppp1r12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    116670 (Ppp1r12a)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    116670 (Ppp1r12a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    116670 (Ppp1r12a)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    116670 (Ppp1r12a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    116670 (Ppp1r12a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     116670 (Ppp1r12a)
SSDB
Motif
Pfam: Ank_4 Ank_2 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 116670
NCBI-ProteinID: NP_446342
RGD: 620013
Ensembl: ENSRNOG00000004925
UniProt: Q10728
Position
7
AA seq 976 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMENNQPQKTFKNKETLIIEPEKNASRIESLEQEKADEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPMASVTNAHTASTQAAPAAVTTPTLSSNQGTPTSPVKKFPTSTTK
ISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVIRSASSPRLSSSL
DNKEKEKDNKGTRLAYVAPTIPRRLGSTSDIEEKENRESSNLRTSSSYTRRKWEDDLKKN
SSINEGSTYHRSTSNRLWAEDSTEKEKDSAPTAATIPVAPTVVSAAASSTTALTTTTAGT
LSSTSEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSR
STRTREQENEEKDKEEKEKQDKEKQEEKKESEVSREDEYKQKYSRTYDETYARYRPVSTS
SSSTPSSSSLSTLGSSLYASSQLNRPNSLVGITSAYSRGLTKDNEREGEKKEEEKEGEDK
SQPKSIRERRRPREKRRSTGVSFWTQDSDENEQERQSDTEDGSSKRDTQTDSVSRYDSSS
TSSSDRYDSLLGRSASYSYLEERKPYGSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTN
MELTDLKLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRL
KDENGALIRVISKLSK
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcccgtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctcgccgcctgctccagcggcgacacggacgaggttctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcaccgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatatcaat
caacctgacaatgaaggctggattccactccatgcagccgcttcctgtggatatctggat
attgcagaatttttgattggtcaaggagcacatgtaggagctgtcaacagtgaaggtgac
acacctttagatattgcagaggaggaagcaatggaagagctacttcaaaatgaggttaat
cggcaaggtgttgatatagaagcagctcgaaaagaagaggaacgcataatgcttagagac
gcgaggcagtggttgaacagtggtcacatcagtgacgtccggcatgcaaagtccggaggc
acagcactccacgtggcagcggccaaagggtatacagaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cactggggtaaagaagaagcatgtcggattttagtggacaatctgtgtgatatggagacg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttgggatatcta
gaggagttgcaaaaaaaacaaaatctgctccatagtgaaaagcgggataagaaatctcca
ctgattgaatcaacagcaaatatggaaaataatcaaccacagaagacttttaaaaacaag
gaaacgttgattattgagccagagaaaaatgcatctcgaatcgagtctctggagcaagaa
aaggctgatgaggaggaggaaggcaagaaggatgagtccagctgctccagtgaggaggat
gaggaggatgactccgagtccgaagcggagacagataagacaaaacccatggcttctgta
actaatgctcacactgccagcactcaggcagctcctgccgctgtgacaacacctactctg
tcttccaaccaggggacccctacatcacctgttaaaaagtttcctacatcaactacaaaa
atttctcccaaagaagaagaaagaaaagatgaatctcctgcatcctggaggttaggactt
agaaagactggcagttatggtgccctggctgagatcactgcatctaaagaagctcagaag
gagaaagacactgcaggcgtgatacgttcagcttcgagtcccagactctcgtcctctttg
gataataaagaaaaggagaaagacaataaaggaacaagacttgcatatgtcgcccctaca
atcccaaggcgactaggcagtacgtctgacattgaagagaaggaaaacagagagtcttca
aatttgcgaacaagtagttcttacacaagaagaaaatgggaagatgatcttaaaaaaaat
agttcaatcaatgaaggatctacttaccatagaagtacctcaaatcgtttgtgggctgag
gatagtactgagaaagagaaggacagtgctcctaccgcagcgaccattcctgttgctcca
actgttgtaagtgctgcagcttcttctaccacagccctgaccacaactactgctggcact
ctttcctccacatcagaggtcagggagagacgcaggtcatacctcactcctgttagggat
gaagagtctgaatcccaaaggaaagcaagatctagacaagcaagacagtctagacggtca
acacagggggtgacactgactgacctccaggaagccgaaaagacaataggaagaagccgt
tctacgagaaccagagaacaagaaaacgaagaaaaagacaaagaagaaaaggaaaagcag
gataaagagaaacaagaagaaaagaaggagtcagaagtatctagagaagatgaatataag
caaaagtattccagaacatacgatgagacttatgcacgttacagaccagtgtcaacttca
agttcaagcactccgtcgtcctcctcactttctactctaggcagttcactctatgcctca
agtcagctcaacaggccaaacagccttgtaggtataacctctgcctactcccggggatta
accaaagacaatgaaagagagggagagaaaaaagaagaggaaaaagaaggggaagataag
tcacaacctaaatcaatcagagaacgacggcgaccaagagaaaaacggaggtctactgga
gtctccttctggacacaagatagtgatgaaaatgagcaagagcggcagtcagacaccgag
gatggctccagcaagagggacactcagacggattctgtttccaggtatgacagcagttcc
acgtcatcaagcgatcggtatgactccttgctgggtcgttctgcctcatacagttactta
gaagaaaggaaaccatatggtagccgactagaaaaggatgactcaactgacttcaaaaag
ctttatgaacaaatcttagctgaaaatgaaaaactaaaggcacagctacatgacacaaat
atggaactaacggatctaaagttgcagttggaaaaagctacccagagacaagaacgattt
gctgacaggtcactattggagatggaaaaaagggaacgaagagctctagaaagaagaata
tctgagatggaagaggagctcaaaatgttaccagacttaaaagcagacaaccagaggcta
aaggatgaaaatggggccttgatcagagttataagcaaactttccaagtag

KEGG   Rattus norvegicus (rat): 24668
Entry
24668             CDS       T01003                                 

Gene name
Ppp1ca
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04720  Long-term potentiation
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04921  Oxytocin signaling pathway
rno04931  Insulin resistance
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    24668 (Ppp1ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    24668 (Ppp1ca)
   04024 cAMP signaling pathway
    24668 (Ppp1ca)
   04022 cGMP-PKG signaling pathway
    24668 (Ppp1ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24668 (Ppp1ca)
   04218 Cellular senescence
    24668 (Ppp1ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24668 (Ppp1ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24668 (Ppp1ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24668 (Ppp1ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    24668 (Ppp1ca)
   04921 Oxytocin signaling pathway
    24668 (Ppp1ca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24668 (Ppp1ca)
   04270 Vascular smooth muscle contraction
    24668 (Ppp1ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    24668 (Ppp1ca)
   04720 Long-term potentiation
    24668 (Ppp1ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24668 (Ppp1ca)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    24668 (Ppp1ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    24668 (Ppp1ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    24668 (Ppp1ca)
   05034 Alcoholism
    24668 (Ppp1ca)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24668 (Ppp1ca)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24668 (Ppp1ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24668 (Ppp1ca)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    24668 (Ppp1ca)
   03019 Messenger RNA biogenesis [BR:rno03019]
    24668 (Ppp1ca)
   03041 Spliceosome [BR:rno03041]
    24668 (Ppp1ca)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24668 (Ppp1ca)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     24668 (Ppp1ca)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     24668 (Ppp1ca)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     24668 (Ppp1ca)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    24668 (Ppp1ca)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 24668
NCBI-ProteinID: NP_113715
RGD: 3375
Ensembl: ENSRNOG00000018708
UniProt: P62138
Position
1
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggattccatcatcgggcgcctgctggaagtgcag
ggctcacggcctggaaagaatgtgcagctgacagagaacgagatccgtggtctttgcctc
aaatcccgggagattttcctgagccagcctattcttctggagcttgaggcgcctctcaag
atctgtggtgacatccatggccagtactatgaccttctacggctgttcgagtatggtggc
ttccctccagagagcaactacctcttcttgggggactatgtggatcggggaaagcagtct
ttggagaccatctgcttgttgctggcctataagatcaaatacccggagaatttctttcta
ctacgtgggaaccatgagtgtgccagcatcaaccgcatctatggcttctatgatgaatgc
aagagacgatacaacatcaaactgtggaagactttcaccgactgcttcaactgcctgccc
attgcagccattgtagatgagaagatcttctgctgccacggaggcctgtctccagacttg
caatccatggagcagattagacgtattatgcggcccacggacgtgcctgaccagggcctg
ttgtgtgatctgctgtggtctgaccctgacaaggatgttcaaggctggggcgagaatgac
cgtggagtctcctttacctttggggccgaggttgtagccaagttcctgcacaagcatgat
ttggacctcatctgcagagcacatcaggttgtagaagatggctatgagttctttgccaag
aggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgctggc
gccatgatgagtgtggacgagacactcatgtgttccttccagatcctcaagcccgctgat
aagaataaggggaagtatgggcagttcagtggcctgaaccccggaggccgtcccatcact
ccaccccgcaattctgccaaagccaagaaatag

KEGG   Rattus norvegicus (rat): 24669
Entry
24669             CDS       T01003                                 

Gene name
Ppp1cc
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform 1
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04720  Long-term potentiation
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04921  Oxytocin signaling pathway
rno04931  Insulin resistance
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    24669 (Ppp1cc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    24669 (Ppp1cc)
   04024 cAMP signaling pathway
    24669 (Ppp1cc)
   04022 cGMP-PKG signaling pathway
    24669 (Ppp1cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24669 (Ppp1cc)
   04218 Cellular senescence
    24669 (Ppp1cc)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24669 (Ppp1cc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24669 (Ppp1cc)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24669 (Ppp1cc)
  09152 Endocrine system
   04910 Insulin signaling pathway
    24669 (Ppp1cc)
   04921 Oxytocin signaling pathway
    24669 (Ppp1cc)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24669 (Ppp1cc)
   04270 Vascular smooth muscle contraction
    24669 (Ppp1cc)
  09156 Nervous system
   04728 Dopaminergic synapse
    24669 (Ppp1cc)
   04720 Long-term potentiation
    24669 (Ppp1cc)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24669 (Ppp1cc)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    24669 (Ppp1cc)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    24669 (Ppp1cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    24669 (Ppp1cc)
   05034 Alcoholism
    24669 (Ppp1cc)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24669 (Ppp1cc)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24669 (Ppp1cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24669 (Ppp1cc)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    24669 (Ppp1cc)
   03019 Messenger RNA biogenesis [BR:rno03019]
    24669 (Ppp1cc)
   03041 Spliceosome [BR:rno03041]
    24669 (Ppp1cc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24669 (Ppp1cc)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     24669 (Ppp1cc)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     24669 (Ppp1cc)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     24669 (Ppp1cc)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    24669 (Ppp1cc)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 24669
NCBI-ProteinID: NP_071943
RGD: 3377
Ensembl: ENSRNOG00000001269
UniProt: P63088
Structure
PDB: 
2O8G 2O8A

Position
12
AA seq 323 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatatcgataaactcaacatcgacagtatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaatgaaatccggggactgtgcttg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgaatacggtggc
tttcctccagaaagcaactatttgtttctcggggactatgtggacaggggcaaacagtca
ctagagacgatctgcctcttgctggcctacaaaatcaagtatccggagaacttttttctt
cttagagggaaccatgagtgtgccagcatcaatagaatctacggattttatgatgagtgt
aagagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttaccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcgggc
gccatgatgagtgtggatgagaccctcatgtgctccttccagattttaaagcctgcagag
aaaaagaagcccaatgccacgagacctgtcacaccgccacggggtatgatcacaaagcaa
gcaaagaaatag

KEGG   Rattus norvegicus (rat): 25594
Entry
25594             CDS       T01003                                 

Gene name
Ppp1cb
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04720  Long-term potentiation
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04921  Oxytocin signaling pathway
rno04931  Insulin resistance
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    25594 (Ppp1cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25594 (Ppp1cb)
   04024 cAMP signaling pathway
    25594 (Ppp1cb)
   04022 cGMP-PKG signaling pathway
    25594 (Ppp1cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    25594 (Ppp1cb)
   04218 Cellular senescence
    25594 (Ppp1cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25594 (Ppp1cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25594 (Ppp1cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25594 (Ppp1cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    25594 (Ppp1cb)
   04921 Oxytocin signaling pathway
    25594 (Ppp1cb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25594 (Ppp1cb)
   04270 Vascular smooth muscle contraction
    25594 (Ppp1cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    25594 (Ppp1cb)
   04720 Long-term potentiation
    25594 (Ppp1cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25594 (Ppp1cb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25594 (Ppp1cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    25594 (Ppp1cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    25594 (Ppp1cb)
   05034 Alcoholism
    25594 (Ppp1cb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25594 (Ppp1cb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25594 (Ppp1cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25594 (Ppp1cb)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    25594 (Ppp1cb)
   03019 Messenger RNA biogenesis [BR:rno03019]
    25594 (Ppp1cb)
   03041 Spliceosome [BR:rno03041]
    25594 (Ppp1cb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     25594 (Ppp1cb)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     25594 (Ppp1cb)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     25594 (Ppp1cb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     25594 (Ppp1cb)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    25594 (Ppp1cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 25594
NCBI-ProteinID: NP_037197
RGD: 3376
Ensembl: ENSRNOG00000004612
UniProt: P62142
Position
6
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccgcctgctggaggtacgagga
tgtcgtccgggaaaaattgtgcagatgactgaagcagaagtccgaggactgtgtatcaag
tctcgtgaaatctttcttagccagcctattcttttggaattggaagcgccactgaagatt
tgtggagatattcatggacagtatacagacttactgagattatttgaatatggaggtttt
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatctgtttgctattggcttacaaaatcaaatacccagagaacttctttcttcta
cgaggaaaccatgagtgtgctagcatcaaccgcatttatggattctatgatgagtgcaaa
cgaagatttaatattaaattgtggaagacattcactgattgttttaattgtctgcctata
gctgctattgttgatgagaaaatcttctgctgtcatggaggactgtcaccagacctacag
tctatggaacagattcggagaattatgagacccactgacgtacctgatacaggtttgctt
tgtgatttactgtggtccgacccagataaggatgtacaaggctggggagaaaatgatcgt
ggtgtttcttttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgatttg
gacttgatttgtcgagcccatcaggtggtagaagatggatatgaattttttgctaaacga
caattggtaactttattttctgccccaaattactgcggcgagtttgacaatgctggtggt
atgatgagtgtggatgaaactttgatgtgttcattccagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtgggctgaattctggacgtcctgtcactccgcctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Rattus norvegicus (rat): 304813
Entry
304813            CDS       T01003                                 

Gene name
Ppp1r12b
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04510  Focal adhesion
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    304813 (Ppp1r12b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    304813 (Ppp1r12b)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    304813 (Ppp1r12b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    304813 (Ppp1r12b)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    304813 (Ppp1r12b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    304813 (Ppp1r12b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     304813 (Ppp1r12b)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 PRKG1_interact Ank Ank_3
Other DBs
NCBI-GeneID: 304813
NCBI-ProteinID: NP_001100648
RGD: 1309287
Ensembl: ENSRNOG00000051440
UniProt: D3ZIC4
Position
13
AA seq 993 aa
MAELEHLGGKRAESARARRAEQLRRWRGSLTEQEPAERQGAGRQLQTRRGSPRVRFEDGA
VFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANINQQ
DNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQDVLRSEKETRNKLIESDLNSKFQSGLFKNKEKMLYEEEIPKSQETEEENKESSSS
SSEEEEGEDEVSESETEKEADKKPEVTVNHSNSESKSRIVEQIPTPAQNTFSASSARRLS
GLFNKAEEPKDESPSSWRLGLRKTGSHNMLSEVTNPREALRDRGSSIYRSSSSPRISTLL
DDKDKERENRSYFSTLVPRRLSGTSDIEEKENRESAVNLVRSGSHTRQLWRDEAKGNETP
QTVAPSTYTSTYLKRTPYKSQADSTAERTDSGSSSTPLCVITNRPAPSTANGVPAATVLS
SPAADASVEPREQRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAEKTFS
RSRAERQAQEQPGEKLEDSGELEGSTKKQEPSAAPTKEAGEGQQPWGRSLDEEPIYHRLR
CPTQPDKLTAPVSPSASRPSLYTGSQLLHTSRASVPDPEATTNTTAAKEMDTSEKEEADL
DDQSSNRLSVRERRRLRDRRRGTGINFWTKDEDETDVSEEVKEAWHERLSRLESGGSNPT
SSDSHSDRASARARREAREARLASLTSRVEEDSSRDYKKLYESALTENQKLKTKLQEAQL
ELADIKAKLEKMAQQKQEKTSDRSSVLEVEKRERRALERKMSEMEEEMKNLHQLKQIQTL
KQMNEQLQAENRALTRVVARLSRSVESSDTQEL
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggcggagctggaacacctgggagggaagcgagcagagtcggcgcgagcccggcgggct
gagcagctgcggcgctggcggggctcgctgacagagcaggagcccgcggagcgacagggc
gcggggcgccagctgcagaccagacgcgggagccccagggtccgcttcgaggatggtgcg
gtctttctggctgcctgctccagcggggacacggacgaggtgaaaaagcttctggcaaga
ggtgcggacatcaacacagtcaacgtggacggcttgacagccctgcaccaggcctgtatt
gatgagaatttggacatggtgaagtttctggtggagaacagagccaatataaaccagcaa
gacaacgagggctggacacccctgcatgcagcagcttcctgtggttatctcaacatagca
gagtattttattagccatggagccagtgtgggtattgtgaacagtgaaggggaagttcct
tctgaccttgcagaagagcctgccatgaaagatcttcttctggaacaagtaaagaagcaa
ggagttgatctggagcagtcgaggaaggaggaagaacagcagatgttgcaggatgcccgc
cagtggctcaacagtgggaagatagaagacgtgaggcaggctcgctctggggccacagct
ctgcatgtagctgctgccaagggttactccgaagtcctcagacttctcattcaggctggc
tatgaactcaatgttcaggatcatgatggctggactcctcttcatgctgctgcacactgg
ggagtgaaagaggcttgttccatcctggcagaagccctctgtgacatggatatccggaac
aaactgggccagacgccattcgatgtggccgatgaaggccttgtggaacacttggagatg
cttcagaagaagcaagatgtgcttcgaagtgaaaaggaaacacggaataagcttattgag
tcagacctgaatagcaagtttcaaagtggactctttaagaacaaagagaagatgctttat
gaagaagagattcccaagtcccaagaaacagaggaagagaacaaagaatccagcagctcc
agctcggaggaggaggaaggggaagatgaagtttctgaatcagaaactgagaaggaggca
gataaaaagccagaagtgactgtcaaccattccaactctgaaagcaagagtcggatcgtg
gagcagatcccaacccccgctcagaacaccttctctgcctcttcagctaggagattgtcc
ggtcttttcaacaaggcagaagagcctaaagatgaatctccttcttcatggagactggga
ctcagaaaaactggtagccacaacatgctgagtgaagtgaccaatcccagggaggccctc
agggaccgaggctcttccatctaccgttcctcctcaagccctcggatctccactttgctg
gatgacaaagataaggaaagagaaaacagaagctatttcagtacactagtaccccggagg
ctcagtggcacaagtgacattgaagaaaaggagaacagagagtcagctgttaatctagta
aggagtggctcccacaccaggcagctgtggagggatgaagcaaagggaaatgaaacccca
cagacagtcgctccttccacttacacgtcaacttacttgaaaaggactccttacaaatct
caggctgactcaacagcagagagaacagacagcggctcctccagcacccccctgtgtgtg
atcaccaaccgccctgcaccaagcactgccaatggggttccagccgccacggtgctctcc
tcccctgcagcagacgcctctgtggaaccccgggagcagaggaggtcttatctgactcct
gtacgggatgaggaggcagagtctttacggaaagcacgctccagacaagctcggcagaca
cgaaggtctactcaaggtgttaccctaacagacctccaagaggcagaaaagactttcagc
cgatcgagggcagagagacaagcgcaggaacagcctggtgagaagcttgaagattctggt
gaacttgaagggagcaccaagaagcaggaaccgtcagcagccccaacaaaggaagctggc
gagggccagcaaccttggggcagaagtctggatgaagagcctatttatcatcgcctaagg
tgtccaactcagccagacaaactcacggcaccagtttctccttctgcgtcaagaccctca
ctatacactggttctcagctactgcacacaagtagagcttcagtccctgacccagaggcc
accacaaacaccacagcggcaaaggaaatggacacgagtgagaaagaagaagctgatttg
gatgatcagtcctccaacaggctgtctgtccgtgagaggagacgacttagagatcggcga
agaggcacaggcattaatttctggacaaaggacgaggatgaaacagatgtctctgaagag
gtcaaagaagcatggcatgaaagactttctaggttggagtcaggaggcagtaacccgacc
agcagcgactctcacagtgaccgtgcttcagcaagagcccgtcgggaggccagggaggct
cgtctagccagcctgaccagccgggtagaagaggacagcagcagggattataaaaaactc
tatgagagtgccctgaccgaaaaccaaaagctgaaaacaaagcttcaggaggcccagctg
gaacttgctgatatcaaagccaagcttgagaagatggcccagcagaaacaagagaagacc
tctgaccggtcctcggtgctggaggtggagaagcgggagaggcgagcgctggagcggaag
atgtcggagatggaggaagagatgaagaaccttcaccagctaaaacagattcaaaccttg
aagcagatgaacgagcaactgcaggctgagaacagggccctgacccgagtggtggccaga
ctctccaggtccgtcgagtcctcggacacgcaggagctctag

KEGG   Rattus norvegicus (rat): 499076
Entry
499076            CDS       T01003                                 

Gene name
Ppp1r12c
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04510  Focal adhesion
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    499076 (Ppp1r12c)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    499076 (Ppp1r12c)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    499076 (Ppp1r12c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    499076 (Ppp1r12c)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    499076 (Ppp1r12c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    499076 (Ppp1r12c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     499076 (Ppp1r12c)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 499076
NCBI-ProteinID: NP_001178875
RGD: 1584883
Ensembl: ENSRNOG00000053828
UniProt: A0A0G2K4R1
Position
1
AA seq 784 aa
MSGEDGPAAGPGAAAAAAAARERRQEQLRQWGARAGADPGPGERRARTVRFERAAEFLAA
CAGGDLDEARLMLRAADPGPGSGAATDPAVPPPARAVLDSTNADGISALHQACIDENLEV
VRFLVEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAES
DAMEGLLKAEITRRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAA
KGYIEVMRLLLQAGYDTELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRP
CDLADEDVMNLLEELAQKQEDLRNQKEASQGRGQESQVPSNSKHRRSSVCRLSSREKISL
QDLSKERRPGGAGGLPIGDEDEGEEALAEHPAVEPRALNGVSSPASSSPKSPVPPEEAPF
SRRFGLQKTGSSGALGPSERKGTEGVLGLQRSASSSVIEKASTQAREPRLARITPTPAQK
VPEPFTLSEAAAPPSDHSAPPSRTEPGSPVKPNVLTASAAPLADSRDRDRRRSYQMPVRD
EESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKVAGKVPEPEQPALPSLDPSRRPRVPG
VENAEGPAQRAEAPEGQGQGPQAAREHRKAGHERRGPAEGEEAVPAERSPECSTVDGGST
VRRQRSQRDLILESKQQHEEPDGGFRKLYTELRRENERLREALTETTLRLAQLKVELERA
TQRQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVIS
KLSK
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgtccggcgaggatggcccggcagcgggcccgggggcggcggcggctgcagcggccgcc
cgtgagcggcggcaggagcagctgcggcagtggggggcgcgggcgggcgctgacccgggc
cccggggagcggcgtgcccgcactgtccgcttcgagcgcgccgccgagtttctggcggcc
tgtgcaggcggtgatctggacgaggctcgcctgatgctgcgtgcagcggatcctggtccc
gggtccggcgctgcgactgaccccgctgtccctccgcctgcccgtgcggtgctcgactct
accaacgccgatggcatcagcgccctgcaccaggcctgcatagatgagaacctggaagtc
gttcgcttcctggtggagcagggtgctactgtgaaccaggcagacaacgagggctggacg
cctctgcatgtggctgcctcctgtgggtacctggacattgctaggtacctcctgagccat
ggggccaacatcgctgctgtcaacagtgacggggacctgcctttggacctggctgagtca
gatgccatggagggactgctgaaagcagagatcactcgccgaggtgtggatgtcgaggca
gccaagcgggctgaagaagaactgctgcttcacgacacaaggtgctggctgaatgggggt
gctatgccagaggcccggcacccccggactggggcctctgccctgcatgtggctgctgcc
aagggctacattgaggtgatgaggttgctactccaagctggctatgacacagagctccgg
gatggagatggctggacacctttgcatgcggcagcccactggggtgtggaggatgcctgc
cgtctactggctgagcatggtgggggcatggattcactgacccacgcggggcagcgtccc
tgtgatctggctgatgaggatgtgatgaaccttttggaggaactggctcagaaacaggag
gaccttcggaaccaaaaggaagcctctcagggccgaggccaggagtcacaggtcccttca
aacagcaagcacagaaggagctcagtgtgccgtttgagcagccgtgaaaagatctccctg
caggatctatcaaaggaacgccggcctggtggggcaggagggctccctattggagatgag
gatgagggagaagaagccttagctgagcatccagctgtggagccaagagcccttaatggt
gtgtcttcccctgcgtcctccagccctaagagccctgtgccgccagaagaggctcccttc
tccaggcgctttggtctccaaaagacagggagctctggtgctttgggtccttcagaaagg
aagggtacagagggagttctcggtctgcagcgctcagcctcctcctcagtcattgaaaag
gcctccactcaggccagggagccccgtcttgccagaataacccctacccctgcccagaaa
gtgccagagcccttcaccctgtctgaggctgcagcaccgccttcggatcactccgctcca
ccctccaggacggagcctggatccccagtgaagccaaatgtcctcacagcctctgcagca
ccgctggctgactccagggatcgggatcgtcggaggtcctaccagatgcctgtgcgtgat
gaggagtctgagtctcagcggaaggctcgctcccgccttatgcgacagtctcggaggtcc
acacagggtgtaactttgacagacttgaaggaggcagaaaaggtggccggaaaggtccca
gagccagagcagcctgccctgcccagcctggacccttctcggagacctcgggtccctgga
gtggagaacgctgagggccctgcccagagagcagaggcgcccgaagggcagggccaggga
ccacaggcggccagggaacatcgaaaagctggccatgagcggagggggccggcagagggg
gaagaggcggtgcctgcggaacggagcccagagtgcagcactgtggatggtggatccacg
gtccgcaggcagcgctcacagagagacctcattctagaatccaagcagcaacacgaagag
cctgatggaggcttccggaagctgtacacggagctccgcagggagaatgaacgacttcgt
gaagccttgacagagaccaccctgcgtctggcacagctcaaggtggagctggagcgggcc
acacagcggcaggaacgctttgctgagaggcctgccctccttgaactggagagatttgag
cgcagagctcttgagcgaaaggcagcagagctggaggaggagctgaaggccctgtctgat
ctccgggctgacaaccaacggctcaaggatgagaatgcagcattgatccgagtcattagc
aagctatccaagtga

DBGET integrated database retrieval system