KEGG   Rattus norvegicus (rat): 100363270Help
Entry
100363270         CDS       T01003                                 

Gene name
Btbd18
Definition
(RefSeq) BTB domain containing 18
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BTB
Motif
Other DBs
NCBI-GeneID: 100363270
NCBI-ProteinID: XP_002729248
RGD: 2323370
Ensembl: ENSRNOG00000043106
UniProt: D3Z9A5
Position
3q24
AA seq 724 aa AA seqDB search
MCSPASPKILYRNPRFLRVAFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFT
ERLERERPVQGRKVVLELGGLKIQTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSEL
ETLQLEGGKLVKAPQGRRLNRECLQPPSAAPISARVVVPRSRPRTPLPVTQTPSPLGAVK
LKSLGEEEGAHKKSNLPNADNLSDTLLLKKKARVCLTQERSSSPSSQREGPKENKSNPGS
TALPSLYPSVDEQLLPRKIRLSRSKPSPHVYTSKPSSMLSGPSSMPTAPGRRLWRQRTVS
EATQGVDKQKPGEVSTLQSTPDPPDVGKTGGKKQPSPESRAPASNSVEEGQVGRVKLRKI
VNGTCWEVVQEPPIRNTQDSPQILESSDADEPPGTLLSSVNEQEIPARIQLCHDSPENSR
LQDILLSASHSPDHPVVKSEFGSSPMLTGKEPELNIDCREPYTFDTTLLSQPCEAEQYRI
TSAAATSELEEILDFMLCGSDVEPPVGSLESPGAEGCRTPSYHLSETGKNWIEGEEWCLP
DMELWPRDLTGLEKEPVGENKEPVEPFSPLVMRSENTESIEPLSPLVMPSEVSREELSLR
GSWTPDLEITSSQPLDGQGEKLIHLDSSDPSQRSYSDLSPPCPNWADTGLEVSLGMDEVL
CPVPKAVREVSANPELLDPFPGSSEDEEIDVVDWTVEGKLGPTSVPSVWPDPSSESETEV
DILT
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctcctgccagtcccaaaatcctgtacaggaatccccggttcctccgggtagct
tttctgcagcttcatcaccagcagcagagtggtgtgttttgtgatgcccttctgcaggca
gagggtgaggctgtcccagcccactgctgcatcctgtctgcctgtagtcccttcttcaca
gaacgcttggagcgggaaaggccagttcaaggtcggaaggtggtgctggagctgggaggc
ctaaagatccagacactaaggaagcttgtggacttcctgtatacgtcagagatggaagta
tctcaggaagaagcccaggatgtgctgtctgctgcccgtcagctccgagtgtcagagctg
gaaacccttcagctagagggcgggaagttagtaaaggctcctcagggccgaagacttaac
agagagtgcttacaaccaccaagtgctgcaccaatctctgccagagtagtggtacccagg
agccgccctcgaactccactgcctgtcacccaaactccaagtcctcttggggcagtgaag
ttgaagtccttaggggaagaagagggggctcacaaaaagagcaacctaccaaatgcagat
aacttgtcagacactcttctactcaagaagaaagccagagtttgcctgactcaagaaaga
agttcatctccatcaagccagagagaagggcctaaggaaaacaagagtaaccctggttcc
acagcactccccagtttgtacccttctgtggatgagcaacttttgcccagaaagatcagg
ctgagccgctcaaagccatccccccatgtctatacatctaagccttccagcatgttaagt
ggtcccagctcaatgcccacagcccctggccggcgtctttggagacagagaactgtaagt
gaagcaacacagggtgtagataagcagaagccaggagaagttagtactctacagagcact
ccagacccacctgatgtcgggaagacaggtgggaagaagcagccaagccctgaatccaga
gcccctgcctccaattctgtagaggaggggcaggttggaagagtaaaacttagaaagatt
gtcaatggtacctgctgggaggttgtacaggagcctcccatcagaaacactcaagatagc
ccccagatcctagaatcctcagatgcagatgagcctccgggaactctgctgtcctcagtt
aatgagcaggaaatacctgctagaatacaactgtgtcatgactcccctgagaactctaga
cttcaagacattctgctctctgctagccactccccagaccacccagtggtgaagtcagag
tttgggtccagtccaatgctgacagggaaggaacctgagttgaatattgactgcagagag
ccctacacatttgacacaaccttgcttagccaaccttgtgaggctgagcaatatcgaatc
acaagtgctgcagccaccagtgaactggaagagattttggactttatgctatgtggctca
gatgttgaaccaccagtaggatctttggagagtcctggggctgaaggctgcagaacccca
agttatcacctgtcagaaacaggaaagaattggattgaaggggaagaatggtgtttgcca
gacatggaactctggcccagagacctcacaggattggaaaaagaaccagttggtgagaac
aaagagccagttgagccctttagtccccttgtcatgcgctctgagaacacagaatcaatt
gagcccctcagcccccttgtcatgccctctgaggtgagtagagaggaactttctctaaga
ggctcttggactccagaccttgaaattaccagctcccagccactggatggtcagggagaa
aaacttatccaccttgactcctctgacccttcccagaggtcttatagtgatctctctcct
ccatgcccaaactgggccgacacagggctggaagtgtccctaggcatggatgaggtattg
tgtcctgttcccaaggcagtcagggaagtgtctgccaaccctgaactgctggacccattt
cctggcagttctgaagatgaagagattgatgtggtagactggacagtggaagggaagctg
gggcccactagtgttccctctgtctggcctgatccttcctcagagtcagaaacagaggta
gatatactaacatag

DBGET integrated database retrieval system