KEGG   Rattus norvegicus (rat): 100363294
Entry
100363294         CDS       T01003                                 

Gene name
SLBP2
Definition
(RefSeq) stem-loop binding protein-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SLBP_RNA_bind
Other DBs
NCBI-GeneID: 100363294
NCBI-ProteinID: NP_001257345
RGD: 2323347
Ensembl: ENSRNOG00000052628
UniProt: I2C088
Position
18p12
AA seq 169 aa
MSLSSRMEMVSVGVTTEPCHARWEVETDEVVLRRRQKQMDYGKCTPGYQSFLQQVPRAQR
QPGFHPQTPNKNRRYSRRSWDAQIRQWRRALHTWDPPSQPFHDRQAEGKAAGNFLRPVDT
APLDDFLDNWPQDPESSENWDRGEKEAQFAYLKVPASCPPQLKDELLHH
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtctttgtcctctaggatggagatggtaagtgtgggagtcaccacagagccttgtcat
gccaggtgggaagttgagacagatgaagtggtcctgaggcggcggcagaagcagatggac
tatggcaagtgcacacctgggtaccagagctttctgcagcaggtccccagggcacagcga
cagccgggttttcaccctcaaacaccaaacaaaaacaggaggtacagccgcagatcctgg
gatgcccagatcaggcagtggagaagagccctgcatacctgggaccccccaagccagcct
ttccatgacagacaggctgaagggaaggcagcagggaacttcctaaggccagtggatact
gctcctttagatgatttcctggataactggccccaggacccagaatcctcagagaattgg
gacagaggcgagaaagaggcccagtttgcatacttgaaggttcctgcttcctgccctccc
cagctcaaagatgaacttctccatcactaa

DBGET integrated database retrieval system