KEGG   Rattus norvegicus (rat): 100363472
Entry
100363472         CDS       T01003                                 

Definition
(RefSeq) nuclear receptor-binding factor 2-like
  KO
K21246  nuclear receptor-binding factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100363472
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100363472
   05014 Amyotrophic lateral sclerosis
    100363472
   05016 Huntington disease
    100363472
   05017 Spinocerebellar ataxia
    100363472
   05022 Pathways of neurodegeneration - multiple diseases
    100363472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100363472
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100363472
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT bZIP_1 DivIC MIT YabA HALZ TPR_7 PRTRC_E DUF5101 TPR_11
Other DBs
NCBI-GeneID: 100363472
NCBI-ProteinID: XP_002728120
RGD: 2322973
Position
14
AA seq 287 aa
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKATAYLSEAMKLTQSEQAHLSLELQ
RDSHMKQLLLIQERWKRAKREERLKAQQSTDRDGVPHLQASHRPSEDSEGQSPLLSQTDI
PSTEKRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIAELKR
HVEFLVAENERLRKENKQLKAEKARLLKGPAEKELDVDADFVEKSELWGLPPHSDTATAS
STWQKFAANTGKAKDIPIPNLRPLDFPSPELPLMELSEDILKGFMND
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaagtgatggaaggacccctcaaccttgctcaccaacagagccgacgggcagaccgt
ttgttagctgctgggaaatacgaagaagcgatttcttgtcacaaaaaggcgacagcctat
ctctctgaagccatgaagctgacacagtctgagcaggctcacttatcactggaactgcaa
agggatagccacatgaagcagcttctcctcatccaggagaggtggaagagagcgaagcga
gaggagcggttgaaagcgcagcagagcacagaccgggatggagtcccccacctgcaggca
tctcacagaccctctgaggactcggaaggccagagccctcttctttctcagacagacatc
ccttccacagagaagcgcctccctgaggtgcagggggtctttgacagggatccagacacg
ttgctatttttacttcagcaaaagaatgagccgtcagagccctgtattggaagcaaggcc
ccaaaagatgataagacgattatagaggagcaggcaaccaagattgcagagttgaagagg
cacgtggagttccttgtggcggagaacgaaagactaaggaaagaaaataaacagctaaag
gctgaaaaggccaggctcctgaagggcccagccgagaaggagctggacgtcgatgcggac
tttgtggagaagtcggagctgtggggcttgccgccacactcggacaccgccactgcctct
tctacctggcagaagtttgcagctaacaccgggaaagccaaggacattccaatacccaac
ctccggcctctggatttcccgtctccagaactccctctgatggagctctcggaggacatt
ctgaaaggattcatgaatgactga

KEGG   Rattus norvegicus (rat): 499670
Entry
499670            CDS       T01003                                 

Gene name
RGD1560263
Definition
(RefSeq) nuclear receptor-binding factor 2-like
  KO
K21246  nuclear receptor-binding factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    499670 (RGD1560263)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    499670 (RGD1560263)
   05014 Amyotrophic lateral sclerosis
    499670 (RGD1560263)
   05016 Huntington disease
    499670 (RGD1560263)
   05017 Spinocerebellar ataxia
    499670 (RGD1560263)
   05022 Pathways of neurodegeneration - multiple diseases
    499670 (RGD1560263)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    499670 (RGD1560263)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    499670 (RGD1560263)
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT bZIP_1 MIT YabA DivIC HALZ TPR_7 PRTRC_E TPR_11 DUF5101
Other DBs
NCBI-GeneID: 499670
NCBI-ProteinID: XP_574989
RGD: 1560263
Ensembl: ENSRNOG00000030494
Position
2
AA seq 287 aa
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKATAYLSEAMKLTQSEQAHLSLELQ
RDSHMKQLLLIQERWKRAKREERLKAQQRTDRDGVPHLQASHRPSEDSEGQSPLLSQTYI
PSTEKHLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIAELKR
HVEFLVAENERLRKENKQLKAEKARLLKGPAEKELDVDADFVEKSELWGLPPHSDTATAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaagtgatggaaggacccctcaaccttgctcaccaacagagccgacgggcagaccgt
ttgttagctgctgggaaatacgaagaagcgatttcttgtcacaaaaaggcgacagcctat
ctctctgaagccatgaagctgacacagtctgagcaggctcacttatcactggaactgcaa
agggatagccacatgaagcagcttctcctcatccaggagaggtggaagagagcgaagcga
gaggagcggttgaaagcgcagcagaggacagaccgggatggagtcccccacctgcaggca
tctcacagaccctctgaggactcggaaggccagagccctcttctttctcagacatacatc
ccttccacagagaagcacctccctgaggtgcagggggtctttgacagggatccagacacg
ttgctatttttacttcagcaaaagaatgagccgtcagagccctgtattggaagcaaggcc
ccaaaagatgataagacgattatagaggagcaggcaaccaagattgcagagttgaagagg
cacgtggagttccttgtggcggagaacgaaagactaaggaaagaaaataaacagctaaag
gctgaaaaggccaggctcctgaagggcccagccgagaaggagctggacgtcgatgcggac
tttgtggagaagtcggagctgtggggcttgccgccacactcggacaccgccactgcctct
tctacctggcagaagtttgcagctaacacggggaaagccaaggacattccaatacccaac
ctcccgcctctggatttcccgtctccagaactccctctgatggagctctcggaggacatt
ctgaaaggattcatgaatgactga

KEGG   Rattus norvegicus (rat): 58839
Entry
58839             CDS       T01003                                 

Gene name
Nrbf2
Definition
(RefSeq) nuclear receptor-binding factor 2
  KO
K21246  nuclear receptor-binding factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58839 (Nrbf2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    58839 (Nrbf2)
   05014 Amyotrophic lateral sclerosis
    58839 (Nrbf2)
   05016 Huntington disease
    58839 (Nrbf2)
   05017 Spinocerebellar ataxia
    58839 (Nrbf2)
   05022 Pathways of neurodegeneration - multiple diseases
    58839 (Nrbf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    58839 (Nrbf2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    58839 (Nrbf2)
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT bZIP_1 DivIC MIT YabA HALZ TPR_7 PRTRC_E DUF5101 TPR_11
Other DBs
NCBI-GeneID: 58839
NCBI-ProteinID: NP_071522
RGD: 61937
Ensembl: ENSRNOG00000000641
UniProt: Q9QYK3
Position
20
AA seq 287 aa
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKATAYLSEAMKLTQSEQAHLSLELQ
RDSHMKQLLLIQERWKRAKREERLKAQQSTDRDGVPHLQASHRPSEDSEGQSPLLSQTYI
PSTEKRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIAELKR
HVEFLVAENERLRKENKQLKAEKARLLKGPAEKELDVDADFVEKSELWGLPPHSDTATAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaagtgatggaaggacccctcaaccttgctcaccaacagagccgacgggcagaccgt
ttgttagctgctgggaaatacgaagaagcgatttcttgtcacaaaaaggcgacagcctat
ctctctgaagccatgaagctgacacagtctgaacaggctcacttatcactggaactgcaa
agggatagccacatgaagcagcttctcctcatccaggagaggtggaagagagcgaagcga
gaggagcggttgaaagcgcagcagagcacagaccgggatggagtcccccacctgcaggca
tctcacagaccctctgaggactcggaaggccagagccctcttctttctcagacatacatc
ccttccacagagaagcgcctccctgaggtgcagggggtctttgacagggatccagacacg
ttgctatttttacttcagcaaaagaatgagccgtcagagccctgtattggaagcaaggcc
ccaaaagatgataagacgattatagaggagcaggcaaccaagattgcagagttgaagagg
cacgtggagttccttgtggcggagaacgaaagactaaggaaagaaaataaacagctaaag
gctgaaaaggccaggctcctgaagggcccagccgagaaggagctggatgtcgatgcggac
tttgtggagaagtcggagctgtggggcttgccgccacactcggacaccgccactgcctct
tctacctggcagaagtttgcagctaacacggggaaagccaaggacattccaatacccaac
ctcccgcctctggatttcccgtctccagaactccctctgatggagctctcggaggacatt
ctgaaaggattcatgaatgactga

DBGET integrated database retrieval system