KEGG   Rattus norvegicus (rat): 100363492Help
Entry
100363492         CDS       T01003                                 

Gene name
Ly6k
Definition
(RefSeq) lymphocyte antigen 6 complex, locus K
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Toxin_TOLIP UPAR_LY6
Motif
Other DBs
NCBI-GeneID: 100363492
NCBI-ProteinID: XP_008763844
RGD: 2322953
UniProt: D3ZNV7
Position
7q34
AA seq 179 aa AA seqDB search
MEGPKGTLRHGLPRKTRHPLEMVILLALLIAVGLPLVKTNVDDEEEKITCHVCESESNLN
CSNPKACDSGKKFCLLAVTRIFERFFYVSKQCTQLCPTPPLFFAETPSEPKGFLVEKPLP
FLFVKCCKWDLCNEKFPVSITMLKQESGKASERRHRYTELLLPGFMVLTANGLSALSLL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggagggacccaagggcacgctgaggcacgggctgccgagaaagactaggcatcctctg
gagatggtgatcctactggccttgctcatagctgtgggcttaccgttggtgaagaccaac
gtggatgacgaggaggagaagatcacctgtcacgtttgtgagtctgagagcaaccttaac
tgctcgaatccaaaggcctgtgattctggcaaaaagttctgtttgttggctgtcacacga
atattcgaacgtttcttctacgtgtcaaaacagtgcacccaattgtgtccaaccccccca
cttttttttgctgaaacaccatctgagcctaaggggtttctggtcgaaaagcccttgccc
ttcttatttgtaaagtgctgtaaatgggacttatgtaatgaaaagtttccagtctccatc
actatgctcaaacaagagtctggaaaagccagtgagagaagacatagatacactgagctg
ttactgcctggcttcatggtccttactgctaatggcctctcagccctcagcctgctgtaa

DBGET integrated database retrieval system