KEGG   Rattus norvegicus (rat): 100363502
Entry
100363502         CDS       T01003                                 

Definition
(RefSeq) cytochrome c, somatic-like
  KO
K08738  cytochrome c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05222  Small cell lung cancer
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100363502
   04215 Apoptosis - multiple species
    100363502
   04115 p53 signaling pathway
    100363502
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100363502
  09162 Cancer: specific types
   05210 Colorectal cancer
    100363502
   05222 Small cell lung cancer
    100363502
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100363502
   05012 Parkinson disease
    100363502
   05014 Amyotrophic lateral sclerosis
    100363502
   05016 Huntington disease
    100363502
   05017 Spinocerebellar ataxia
    100363502
   05020 Prion disease
    100363502
   05022 Pathways of neurodegeneration - multiple diseases
    100363502
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100363502
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100363502
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100363502
   05134 Legionellosis
    100363502
   05152 Tuberculosis
    100363502
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100363502
   05161 Hepatitis B
    100363502
   05160 Hepatitis C
    100363502
   05164 Influenza A
    100363502
   05162 Measles
    100363502
   05168 Herpes simplex virus 1 infection
    100363502
   05163 Human cytomegalovirus infection
    100363502
   05167 Kaposi sarcoma-associated herpesvirus infection
    100363502
   05169 Epstein-Barr virus infection
    100363502
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100363502
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100363502
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100363502
NCBI-ProteinID: XP_003751847
RGD: 2322845
Ensembl: ENSRNOG00000032885
UniProt: P62898
Structure
PDB: 
5C0Z 5DF5 5C9M 6N1O

Position
18q12.1
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcaaaagtgtgcccagtgccacact
gtggaaaaaggaggcaagcataagactggaccaaacctccatggtctgtttgggcggaag
acaggccaggctgctggattctcttacacagatgccaacaagaacaaaggtatcacctgg
ggagaggataccctgatggagtatttggaaaatcccaaaaagtacatccctggaacaaaa
atgatcttcgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctactaatgaataa

DBGET integrated database retrieval system