KEGG   Rattus norvegicus (rat): 100363539
Entry
100363539         CDS       T01003                                 

Gene name
Mrpl33
Definition
(RefSeq) mitochondrial ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100363539 (Mrpl33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    100363539 (Mrpl33)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    100363539 (Mrpl33)
  Bacteria
    100363539 (Mrpl33)
SSDB
Motif
Pfam: Ribosomal_L33
Other DBs
NCBI-GeneID: 100363539
NCBI-ProteinID: XP_002726748
RGD: 2322809
Ensembl: ENSRNOG00000025388
UniProt: D4ABL7
Position
6q14
AA seq 65 aa
MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNYKRSRLREKLTLLHYDPIVNKKVLFVEQK
KIRSL
NT seq 198 nt   +upstreamnt  +downstreamnt
atgctgctttctgccgtctcttttgccaagagcaagtcaaaaactattctggtaaaactg
gtgagccaagccgggacaggtttctccttcaactacaagagaagccgactccgagagaag
ctgacccttctgcactatgatccaatagtgaacaaaaaagttctctttgtggaacagaaa
aaaatacgctccctctga

DBGET integrated database retrieval system