KEGG   Rattus norvegicus (rat): 100364016
Entry
100364016         CDS       T01003                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100364016
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100364016
   04114 Oocyte meiosis
    100364016
   04115 p53 signaling pathway
    100364016
   04218 Cellular senescence
    100364016
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100364016
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100364016
   05170 Human immunodeficiency virus 1 infection
    100364016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    100364016
   03036 Chromosome and associated proteins [BR:rno03036]
    100364016
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100364016
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100364016
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100364016
NCBI-ProteinID: XP_008756873
RGD: 2321841
Position
1
AA seq 366 aa
MALLRRPTVSSDLKNIDTGVNPKAKSHVTVRRAVLEEIGNKVRARPAQVAKKPQNTKVPV
QPTKAINASKQPKPTASVKPVQMETLAPKDPLPAPEDVSMKEESLCQAFSDALLCKIEDI
DNEDGENPQLCSDYVKDIYQYLRQLEALQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCIAIMDRFLQAQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDM
VHYHPSQVAAAASCLSQKVLGQGKWNLKQQYYTGYMESEILEVMQHMAKNVVKVNENLTK
FIAVKN
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgacggtgtccagtgatttgaagaatattgacacaggagtt
aatcctaaagctaagagccatgtgactgtccggcgagctgttttagaagaaattggaaat
aaagttagagccagaccggctcaagtggctaagaaacctcagaataccaaagtaccagtc
cagcccaccaaagcaataaatgccagcaaacagccgaaacctacagcttctgtgaaacca
gtgcagatggagacactggccccgaaggatcctctgcctgcccctgaggatgtctccatg
aaggaagagagcctctgccaagctttctctgatgctttgctctgcaagattgaggacata
gataatgaggacggggagaaccctcagctctgcagtgactacgtgaaggacatctaccag
tacctcaggcagcttgaggctttgcagtccatcaatccacacttcttagatggaagagac
ataaacggacgcatgcgtgccatcctggtggactggctggtccaagtccattccaagttt
aggcttctgcaggagactctgtacatgtgcattgctatcatggaccggttccttcaggct
cagccagtctgccggaagaagctgcaactggttgggatcacagctctgctcttggcttcc
aaatatgaggagatgttttctccaaatatcgaagactttgtttatatcacagataatgct
tacaccagttcccaaatccgagaaatggagactctgattttgaaagagttgaaattcgag
ttgggccggcctttgccactccacttcctaaggcgagcctcaaaagccggggaggtggat
gttgaacagcacacgttagccaagtacctgatggagctgaccctcgtcgactacgacatg
gtgcattaccacccttctcaggtcgcagctgctgcttcctgcctctctcagaaggtgctg
ggccaaggaaaatggaatttaaagcagcagtattacacaggctacatggagagtgaaata
ctggaagtcatgcagcacatggccaagaacgtcgtgaaagtcaatgaaaacctcaccaag
ttcatcgctgtcaagaactaa

KEGG   Rattus norvegicus (rat): 25203
Entry
25203             CDS       T01003                                 

Gene name
Ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25203 (Ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25203 (Ccnb1)
   04114 Oocyte meiosis
    25203 (Ccnb1)
   04115 p53 signaling pathway
    25203 (Ccnb1)
   04218 Cellular senescence
    25203 (Ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25203 (Ccnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25203 (Ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    25203 (Ccnb1)
   03036 Chromosome and associated proteins [BR:rno03036]
    25203 (Ccnb1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    25203 (Ccnb1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    25203 (Ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 25203
NCBI-ProteinID: NP_741988
RGD: 2291
Ensembl: ENSRNOG00000058539
UniProt: P30277
Position
2
AA seq 423 aa
MALRVTRNTKINTENKAKVSMAGAKRVPVAVAASKPLLRSRTALGDIGNKVSEQSRIPLK
KETKKLGSGTVTVKALPKPVDKVPVCEPEVELDEPEPEPVMEVKHSPEPILVDTPSPSPM
ETSGCAPAEEYLCQAFSDVILAVSDVDADDGGDPNLCSEYVKDIYAYLRQLEEEQSVRPK
YLLGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQDSCVPKKMLQLVGVT
AMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRAS
KIGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEWTPTLQHYLS
HTEESLLPVMQHLAKNIVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNCTLVQNLSKAV
TKA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgctcagggtcactaggaacacgaaaattaacacagaaaataaggccaaggtcagc
atggcaggcgccaagcgtgtgcctgtggcagttgctgcctccaaacccctgctgagatcg
agaactgctcttggagacattggtaataaagtcagcgaacagtcaagaatacccctcaaa
aaggaaacaaaaaagttaggttctggaacagttactgttaaagccctaccaaaacctgtg
gacaaggtgccagtgtgcgaaccagaggtggaactggatgagcctgagcctgaacctgtt
atggaagtgaaacactctcctgagcctattttggttgatactccctctccaagcccaatg
gaaacatctggatgtgcacctgccgaagaatatctgtgtcaggctttctccgatgtgatt
cttgcagtgagtgatgtagatgcagacgatggtggtgatccaaacctctgtagtgaatat
gtgaaagatatctatgcttacctcagacaactggaggaagagcagtcagttagaccaaaa
tacctactgggtcgtgaagtcactggaaacatgagagccatcctaatcgactggctaata
caggttcagatgaaatttcggctgctgcaggagaccatgtacatgactgtgtccattatc
gatcggttcatgcaggacagttgtgtgcccaagaagatgctgcagctggttggtgtaact
gccatgtttattgcaagcaaatacgaggagatgtaccctccagagatcggtgacttcgct
tttgtgactaacaacacttacaccaagcaccagatcagacagatggagatgaagattctg
agagttctgaacttcagtctgggtcgccctctgcctctgcacttcctccgtagagcatct
aaaattggagaggtcgatgtggagcagcatactttggccaaatacctcatggagctctcc
atgctggactacgacatggtgcattttgccccttctcaaattgcagctggggctttttgc
ttagccctgaaaatccttgacaacggtgaatggacaccaactctgcagcactacctgtcc
cacacggaggaatctctgcttcctgtgatgcagcacctggctaagaacatagtcatggtg
aaccgtggcctcacaaagcacatgacgatcaagaacaagtatgcaacatctaagcatgct
aagatcagcactctggcacagctgaattgtacactagttcagaatttgtctaaggccgtg
acaaaggcgtaa

KEGG   Rattus norvegicus (rat): 317389
Entry
317389            CDS       T01003                                 

Gene name
Ccnb3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3 isoform X2
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    317389 (Ccnb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    317389 (Ccnb3)
   04218 Cellular senescence
    317389 (Ccnb3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    317389 (Ccnb3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    317389 (Ccnb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    317389 (Ccnb3)
   03036 Chromosome and associated proteins [BR:rno03036]
    317389 (Ccnb3)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    317389 (Ccnb3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    317389 (Ccnb3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 317389
NCBI-ProteinID: XP_017457748
RGD: 1564367
Ensembl: ENSRNOG00000002951
UniProt: F1LVT0
Position
X
AA seq 1404 aa
MLPKRSKLETEKPQSIKITPREEQQSEKIGKSNHTASASSQGTIKKRSAFEDVTNASYVQ
CVQPKEDNTELKSHISKRTRKGVGEITQKKIKSSKLGHVTSLSNVEKEFILDIPNKPKTL
TTEEPPVFPKTLVLNEQHATEETSLMRKTLKSCAFYQETFLMEKPQTLLEKTKDYKEFDS
ELMTSRRKDKPEEATIIEEMTDLKEPDLGKVTLTSSPLYLKNKHAVQEEKHAIQGKSSFK
KKSLAMKVVTTKENSPVKKPHFRKKKPTTELKSLLQEQSSLQEKYNTQGDASILKKPRVL
QKNINNKVDTLTEPVTLKRKHSTNEAIHTKKLSSSKNNHDTQGKGTNLRPLGVQPVTHEN
EPLSSKKSTTKKKDSHFHGPSVLPDKHSPQMKVSTAKNSLALQNPTTEEMMLHFPVAPVL
KMGQNMEEAPCLKKPSPLRKQQQLPKRSRSFSKCAVQETVTSKSLSFKKSNTKKDPSFQG
PFALQKKRNSPGKLSKQKKRYVPPKHCMEKDSHFQLDSAFKKQHIREEPASTHKPLILEM
QQTTKGTEFRLRNPLVLPTVTSGTKSLTKEPPSFKKENTPLLKRKCATHTITLQQAQLEL
EETTGEDRNLFSTRPELHKKEPTPGLLQDPLPQNENCLIPQQLSFSMPLDSQKITSQERA
HSKESVTSNDDNNFFSQDLFSPFSSTDEDTLKFHKSLDFQEKVDRKNDSPTKMSDSQDSV
SEEESFLRKLFCKGRHSSSEESSQERPVALEQEFLLKKVLNENTSSDVEGPLSHQSPHIQ
NHSGTTKEALEALDALEALDALEALEASETLEALEALEASGALEEPLNIQEELSSEDIVA
IMKSLITEDESIKEAFIRSYTTATEAPAEKSLSLEETSINEVATLKEPLSSQEKHRAELV
TVLKELLVLVKNPRLERLALAFQENPPSNVETLLREVLALVEKSTGEESTLNEPLALQEK
LSTKAELSPKELLALEDNPSFKKASPQGSLTFDHKPDIEKDEITRMSFSFEEFSIDSLYE
KVLALSEGFTTTEQLSFTDLQNFDESKIVDEEDIFKSFFVFENENNPNLSSNGFESRKDN
SSAPMPSLEAFNSVMNSEPCVSATKSSQSSLGGKETEVIILDDSDTQESFVKEDSDLLLS
STYAKNIFIYLKEREEKFIVTKYMDEQMELTSDMRAILVDWMVEVQANFRMSHETLYLAV
KLMDRYLMKAQCEKNHLQLLGSTAYMIAAKFEESYPPSLTEFLYICEDLYPKSEMVSLER
NILKTLNFDINIPIAYHFLRRYASCIHASMKTLTLSRFICEMTLQEYDYIDERPSKLAAA
SFILALYMRNLKDCVPSLEYSTGYQLAELHILVRKLNHLLNFRSRTVLKNVFEKYSEETY
FEVAKIPPLSMKDLEDLLNCALFS
NT seq 4215 nt   +upstreamnt  +downstreamnt
atgttacccaaaagatccaaactagagactgagaagcctcagtcaatcaagatcacaccc
agagaggagcagcaatctgaaaagattggaaagagtaaccatacagcatcagcttcatcc
caaggcacaatcaaaaagagatcagcatttgaagatgttactaatgcatcttatgttcaa
tgtgtccagccaaaggaagacaatacagagcttaaaagccatatttccaaaaggacaagg
aagggagttggtgaaattactcagaaaaaaataaaaagttctaagttgggacatgttacc
tcactgtcaaacgtggagaaagagtttattctggatatacccaacaagcctaaaacacta
actactgaggaaccacctgtctttccaaagacattagttttaaatgaacaacatgctact
gaagagacaagccttatgaggaagacattaaagagttgtgcattttatcaggaaacattt
ctaatggagaagccacaaaccttgctggagaagactaaagattacaaagagtttgattca
gagctgatgacttctagaaggaaggataaacctgaagaggcaaccatcattgaggagatg
actgatttaaaggagcctgatttggggaaggtgactctcacctcaagcccattatattta
aagaataaacatgctgttcaagaagagaagcatgctattcaggggaagagttcattcaag
aagaaatcattagcaatgaaggtggtgactactaaagagaattcaccagtcaaaaagcca
catttcaggaaaaagaaacctaccactgagttgaagtctttgttacaggagcagtcttca
ctacaagagaaatataatactcaaggggacgcaagcatcttgaagaagccaagggtgtta
caaaagaatataaataacaaagttgatactttaacagagccagttactttaaaaaggaaa
catagtaccaatgaagcaatccacacaaagaagctgtcttcttctaaaaataatcatgac
actcagggaaaaggcactaatttgaggccactaggagttcagccagtcacccatgaaaat
gagccattgtcctctaagaagtcaactactaagaagaaagattcccatttccacgggcca
tctgtactgccagataagcatagccctcaaatgaaggtgtccactgcgaaaaactccctg
gctctgcaaaatcctaccactgaagagatgatgttacattttccagtagctccagttttg
aagatggggcaaaacatggaagaggccccttgcctaaagaagccctcacctttaaggaag
cagcagcaactccctaaaaggagtcgttccttcagtaagtgtgcagtacaagaaacagtc
accagcaagtcattgtcctttaagaagtctaacactaagaaagatccctctttccagggg
ccatttgcactgcaaaagaagcgtaacagtcctgggaaattgtcaaaacagaagaagcgc
tatgtcccaccaaagcattgcatggagaaagactcacattttcagttagattcagctttt
aagaaacaacacattagggaggagccagcctccacccataaacctttaatattagagatg
cagcagactactaaagggacggagttccgtttgagaaatccactagtattaccaacagtt
acttcaggaacaaagtcactaactaaggagccaccatcctttaagaaagaaaatacacct
ttactgaaaagaaagtgtgctactcacacaataaccttacaacaagcacagttagagttg
gaggaaacaacaggtgaagatagaaatttgttttctacaaggcctgaattacataagaag
gaacctacacctgggctccttcaggatccattgccacagaatgaaaattgcttaattcca
caacaactatccttctcaatgccattggactcacagaagatcaccagtcaagaaagagca
catagtaaggaatcagtgacttcaaatgatgacaataacttcttctctcaagacctattt
tctcctttcagttctactgatgaagatacattgaaattccataagtctttggactttcaa
gagaaggttgatagaaaaaatgactctcccacaaaaatgtctgactcccaggacagtgtt
tccgaagaagagtcctttttaagaaagctattttgtaagggcagacactcctcctctgaa
gaatcaagccaagagcggcctgttgctctggaacaggaattcctcttaaagaaagtattg
aatgagaataccagtagtgatgttgaggggcctcttagtcatcagtcacctcacattcag
aaccattctggcactacgaaggaggctttggaggccttggatgccttagaagccttggat
gccttagaagccttggaggcatcagagaccttggaggccctggaggccttggaggcctcg
ggagccttggaggaacctttaaacattcaagaagagctcagctctgaggatatagttgcc
atcatgaagtcactgatcacagaagatgagtctattaaggaggctttcatcaggagttac
actactgccacagaagctccagctgagaaatctttgtccttggaagagactagcatcaac
gaggtggcaactctgaaggagcccttatcttcacaggagaaacacagagctgagctggtg
actgttctgaaggagctacttgtcttagtgaagaatcccaggctggagaggttggcctta
gcctttcaggagaatccacccagtaatgtagagactctcttgagggaagtattggcattg
gtggagaaatctacaggtgaggaatctactctgaacgagccccttgccttgcaggagaaa
cttagcactaaagcagagcttagcccaaaggaactattggccttggaagacaatcccagc
tttaaaaaggcaagcccccagggctctttgacctttgatcataagcctgacattgagaag
gatgaaataaccagaatgtcattttcttttgaggagttcagcatagattccctttacgag
aaggtattagcactgagtgagggatttactactacagagcaattgtcctttacagatcta
cagaattttgatgagagtaaaattgttgatgaagaggatattttcaaatcattctttgtc
tttgaaaatgagaataaccctaatttgtccagcaatggttttgaatccagaaaagacaat
tctagtgctcccatgcccagtttagaggcgttcaattctgtcatgaactccgaaccatgt
gtatctgctaccaaaagctctcagtcatctctgggcggaaaagagactgaggtcatcata
ttggatgacagtgacacacaggaaagttttgtaaaggaagacagcgatctattattgagc
tctacatatgccaagaacatcttcatttacttgaaagaaagagaggaaaagttcatagtt
acaaaatacatggatgagcagatggaactcaccagtgatatgagagccattcttgtggac
tggatggtggaggtacaggcaaactttcggatgagccatgagaccctgtatttggcagtg
aagctaatggatcgctacctaatgaaggcacaatgcgagaagaaccatctacaactcctt
ggttccactgcctatatgattgcagccaagtttgaggaatcctatcccccttccctaaca
gagttcctgtacatttgtgaagatctttatccaaagagtgagatggtgtccttggaaaga
aacatcctgaaaactctcaactttgacatcaatattcccattgcatatcattttctacgt
agatatgcttcgtgcatccatgctagcatgaagacactaaccttatcccgcttcatctgt
gagatgaccctgcaggaatatgactatatcgacgagaggccttcaaagctagctgcagcc
tccttcatcttggccctctatatgaggaatctcaaggattgtgttccttcactggaatat
tccactggctaccagctggctgaactccatatcttagtcaggaagctaaaccatttgctg
aacttccgatcccgtactgtgctcaaaaatgtgtttgagaagtactctgaagagacctac
tttgaagtcgccaaaatccctcctttgagcatgaaagatctagaggatcttttgaattgt
gcattattcagctga

KEGG   Rattus norvegicus (rat): 363088
Entry
363088            CDS       T01003                                 

Gene name
Ccnb2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    363088 (Ccnb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    363088 (Ccnb2)
   04114 Oocyte meiosis
    363088 (Ccnb2)
   04115 p53 signaling pathway
    363088 (Ccnb2)
   04218 Cellular senescence
    363088 (Ccnb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    363088 (Ccnb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    363088 (Ccnb2)
   05170 Human immunodeficiency virus 1 infection
    363088 (Ccnb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    363088 (Ccnb2)
   03036 Chromosome and associated proteins [BR:rno03036]
    363088 (Ccnb2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    363088 (Ccnb2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    363088 (Ccnb2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 363088
NCBI-ProteinID: NP_001009470
RGD: 1308176
UniProt: Q5M857
Position
8
AA seq 398 aa
MALLRRPTVSSDLKNIDTGVNPKAKSHVTVRRAVLEEIGNKVRARPAQVAKKPQNTKVPV
QPTKAINASKQPKPTASVKPVQMETLAPKDPLPAPEDVSMKEESLCQAFSDALLCKIEDI
DNEDGENPQLCSDYVKDIYQYLRQLEALQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCIAIMDRFLQAQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDM
VHYHPSQVAAAASCLSQKVLGQGKWNLKQQYYTGYMESEILEVMQHMAKNVVKVNENLTK
FIAVKNKYASSRLLKISTIPQLNSRTIKDLASPLMGRP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgacggtgtccagtgatttgaagaatattgacacaggagtt
aatcctaaagctaagagccatgtgactgtccggcgagctgttttagaagaaattggaaat
aaagttagagccagaccggctcaagtggctaagaaacctcagaataccaaagtaccagtc
cagcccaccaaagcaataaatgccagcaaacagccgaaacctacagcttctgtgaaacca
gtgcagatggagacactggccccgaaggatcctctgcctgcccctgaggatgtctccatg
aaggaagagagcctctgccaagctttctctgatgctttgctctgcaagattgaggacata
gataatgaggacggggagaaccctcagctctgcagtgactacgtgaaggacatctaccag
tacctcaggcagcttgaggctttgcagtccatcaatccacatttcttagatggaagagac
ataaacggacgcatgcgtgccatcctggtggactggctggtccaagtccattccaagttt
aggcttctgcaggagactctgtacatgtgcattgctatcatggaccggttccttcaggct
cagccagtctgccggaagaagctgcaactggttgggatcacagctctgctcttggcttcc
aaatatgaggagatgttttctccaaatatcgaagactttgtttatatcacagataatgct
tacaccagttcccaaatccgagaaatggagactctgattttgaaagagttgaaattcgag
ttgggccggcctttgccactccacttcctaaggcgagcctcaaaagccggggaggtggat
gttgaacagcacacgttagccaagtacctgatggagctgaccctcgtcgactacgacatg
gtgcattaccacccttctcaggtcgcagctgctgcttcctgcctctctcagaaggtgctg
ggccaaggaaaatggaatttaaagcagcagtattacacaggctacatggagagtgaaata
ctggaagtcatgcagcacatggccaagaacgtcgtgaaagtcaatgaaaacctcaccaag
ttcatcgctgtcaagaacaaatatgccagcagcaggctcctgaagatcagcacgatccct
cagctgaactccagaaccatcaaagacctggcctcccctctgatgggcagaccctag

DBGET integrated database retrieval system